KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0959Help
Entry
Rhom172_0959      CDS       T01606                                 

Definition
(GenBank) Redoxin domain protein
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1089985..1090467
Genome map
AA seq 160 aa AA seqDB search
MGRQLLSGLFGALLLVGSGWAQTVRPATATEILEVVRESPATVKVVNMWATWCAPCVEEF
PAFVRLQQQYDSSLVRVFFVSADFEDELPAVRRFLQSQGVRFSFLKQGADDAFVRAFSPE
WTGALPATFLYDMAGNLRGFWEGKTTYDQLVEQVQKLLNR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggcagacaattgctgagcgggctgttcggcgcgctgctgctggtcggatcgggttgg
gcccagacggtgcggcccgccacggccaccgaaatcctggaggtcgttcgggaaagtccg
gcgaccgtaaaagtggtcaatatgtgggccacctggtgcgccccctgcgtggaggagttt
cccgcatttgtgcggttgcagcaacagtacgattcgtcgctggtgcgcgtctttttcgta
tcggccgacttcgaagatgaattgccggcggtgcgccggtttctgcaatcgcagggcgta
cgcttctcttttctgaagcagggagccgatgatgcgtttgtaagagccttcagtccggag
tggaccggagccctgccggccaccttcctgtacgatatggccggaaatttgcggggcttc
tgggaaggtaaaacaacctatgaccaactggtcgagcaggtgcaaaaactgctcaaccgg
taa

DBGET integrated database retrieval system