KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0963Help
Entry
Rhom172_0963      CDS       T01606                                 

Definition
(GenBank) hypothetical protein
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1092518..1092877
Genome map
AA seq 119 aa AA seqDB search
MPSQHLQRLRRQMQELVEDLRAWVELRLTLTQLEIEERIEARIRQLLLRLLVGVLAGLAV
VFALVAAALGLGSWLGHPGWGFLVVALGLAAVAAVIHFARKRPAGRTASTNAASDTTAA
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcagcacctgcagcggctgcgtcggcagatgcaggagctggtagaagacctg
cgtgcctgggtggagcttcggctgacgctcacccagcttgaaatcgaagagcggattgaa
gcccgcatccgccagctgctgctgcgcctgctggtgggcgtgctggccggactggccgtt
gtgtttgcgctggtggccgctgcactgggactgggaagctggctcggacatccgggctgg
ggctttctggtcgtggcgctgggactggccgccgtggcggccgtgattcacttcgcccgg
aagcggcccgccggtcggactgcatcaacgaatgcggcatcggatacgacagctgcttaa

DBGET integrated database retrieval system