KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0967Help
Entry
Rhom172_0967      CDS       T01606                                 

Definition
(GenBank) alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal allergen
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1095028..1095597)
Genome map
AA seq 189 aa AA seqDB search
MRFTRRWISWTAPVLLLSSLLLGCRPKAPEQAAASEQVLLPGVEEIKPPRPAPDFEAPGL
DGAPFRLSAHRGSVILLNFWATWCAPCRTEIPDLVALQRELGDRGLLVVGVSTDEEGAEV
VAPFAANFKINYPVVLDDGSVSEAYGGIWALPTTVVIDRAGRIRYEIIGIFPTEEMRPRL
EALLDESAS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcacgagacgctggatcagctggactgcaccggttctgctgctgagtagcctg
ctgctcggctgccggccgaaagcccccgagcaggcggccgcctcggagcaggtgctgctg
cccggggtcgaagaaatcaagccgccccggcccgcgccggacttcgaagcgccggggctg
gacggcgcgccgttccgcctgagcgcccaccggggctcggtgatcctgctgaacttctgg
gccacctggtgtgcaccctgtcgcacggagattcccgacctcgttgccctgcaacgcgaa
ctgggcgaccggggcctgctcgtggtaggcgtctcgaccgacgaagaaggcgccgaagtc
gtggcacccttcgcggcaaacttcaagatcaactaccctgtcgtgctggacgacggctcg
gtctccgaggcctacgggggcatctgggccctgcctaccacggtggtcatcgatcgggcc
ggtcgcatccgctacgagatcatcggcatcttcccgacggaggaaatgcgtccccggctg
gaagccctgctcgacgaatcggcttcctga

DBGET integrated database retrieval system