KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0972Help
Entry
Rhom172_0972      CDS       T01606                                 

Definition
(GenBank) peptidase M24
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1100994..1102112)
Genome map
AA seq 372 aa AA seqDB search
MSQTPHAKRLARLQHLLQEADIDAIALNASPTLSYLTGLEVHLSERPVVGIFPASGKPAL
VLPELETGKLASLPVALEAFPYGENPDAWPEAFAQALRFCGLTQARLGVEPQWFRFLELQ
LLEKAAPEVRVTSAEPVIMRLRSQKDEAEVAATRRALDVAWRALEATLPVIRPGVTERDV
AAELTLQLLRAGSDPALPFSPIVAFGPESANPHAVPGDRPLTPPTLVLIDWGARVEGYCA
DLTRMFAFGPLDDELEQIVRIVLEANEAARARVAPGVPAGEVDRAARQVIEQAGYGPYFI
HRTGHGLGLEIHEPPYIRGDNPEPLAPGMLFTIEPGIYLTGRGGARIEDDVLVTETGAET
LSDYPRTLRRLD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagacaccccatgcgaaacgactggcacgcctgcagcaccttctgcaggaagcc
gacatagacgccatagcgctgaacgccagtcccacgctgagctacctgacgggcctcgaa
gtgcatctgtcggagcggccggtggtggggatcttccccgcttcgggcaagccggccctg
gtgcttcccgagctggagaccggcaaattggcgtcgcttccggtggcgctcgaagccttt
ccctacggcgaaaatccggacgcctggcccgaggcgttcgcgcaggcgctgcgcttctgc
ggcctgacgcaggcgcggctcggcgtcgagccgcagtggtttcgatttctggagcttcag
ttgctggaaaaagccgcgccggaggtgcgcgtcacctcggccgagccggtgatcatgcgc
ctgcgcagccagaaagacgaggccgaggtggccgccacgcgccgggcactggacgttgcc
tggcgcgcgctcgaagcgacgctgccggtgatccgtccgggcgttaccgaacgggacgtg
gcggccgaactgacgctgcaactgctgcgggccggtagcgatccggcgcttccgttttcg
cccatcgtggctttcgggccggaaagcgccaacccgcacgctgtgcccggcgaccggccg
ctgacgccacccacgctcgtgctgatcgactggggcgcgcgcgtcgagggctactgcgcc
gatctgacgcgcatgttcgccttcggaccgctcgatgacgaactggagcagatcgtccgg
atcgtgctcgaagccaacgaagcggcccgggcccgcgtcgcgccgggcgtgccggccggc
gaggtggaccgcgccgcccgccaggtgatcgaacaggcgggctacggcccctacttcatc
caccgcaccggccacggactgggactggagatccacgagcctccgtacatccggggcgac
aatcccgagccactggcgccgggcatgctctttaccatcgagcccggcatctacctgacg
ggacgcggcggcgcccgcatcgaagacgacgtgctcgtcactgagacgggcgccgaaacg
ctcagcgactacccgcgcacgctacgccgtctggattaa

DBGET integrated database retrieval system