KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0975Help
Entry
Rhom172_0975      CDS       T01606                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rhom172_0975
Enzymes [BR:rmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rhom172_0975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1104609..1105325
Genome map
AA seq 238 aa AA seqDB search
MAGEVVYLLRVETTESDPFAEALRAAGYRPFVLPVLSVVWCNTEQLRAVLARSEAYGGLI
FTSPRAVEAVRRLGSLPEAWRRRPVYVVGPRTAAAAQALGLQPRGEAAGSGRELARLILQ
APRPERPLLFLCGARRRDELPALLRAAAFPLEELVVYDTRPSVPELPAEVPDWVVFFSPS
GLEAARRLPIARERVRVAAIGPTTAAALQQEGWPVAAVARTPTPEGLLAAMQEATNLS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgaggtggtttatctgctccgggtggaaacgaccgagtcggacccctttgcc
gaagcgctgcgggcagcgggctaccggccgttcgtgctgccggtgctgtcggtggtctgg
tgcaacaccgagcaactccgggcggtgctggcccggtcggaggcatacggcgggttgatt
ttcaccagcccgcgcgccgtggaggccgtccggcgcctgggatcgctcccggaggcctgg
cgccgacggcccgtgtacgtggtagggccgcgcacggccgccgccgcgcaggcactgggg
ctgcagccccggggcgaagcggccggctccgggcgcgagctggcccggctgatcctgcag
gcaccgcgtccagagcgtccgctgctgtttctgtgcggcgcgcgtcgccgcgacgaactg
ccggcgctgcttcgcgccgccgcgttcccgctggaagaactggtcgtgtacgacacccga
ccgtccgtgcccgaactgcccgccgaggtgcccgactgggtcgtatttttcagtccgtcc
ggtctggaagccgcccgacggcttccgatcgcccgggagcgggtgcgagtggccgccatc
ggtcccacgacggccgcagcgctgcagcaggaaggctggccggtggccgccgtggcccgg
acgcccacgccggaaggcttgctggccgcgatgcaggaagcaaccaacctgtcatga

DBGET integrated database retrieval system