KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0976Help
Entry
Rhom172_0976      CDS       T01606                                 

Definition
(GenBank) protein of unknown function UPF0047
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1105328..1105753
Genome map
AA seq 141 aa AA seqDB search
MWVQRTITLRPRPRGFHLITDDVLAQLPELRSVRVGLLHVFIQHTSASLTLNENASPEVR
ADFERYFSRAVPDGAPYFAHTLEGPDDMPAHIKASLLGSSLLLPVRDGRLALGTWQGIYL
CEHRNHGGPRRLVLTLWGEEG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgcagcgtacgatcaccctgcggccgcgcccgcgcggctttcatctgatcacc
gacgacgtgctggcgcagcttccggagttgcgctcggttcgggtcggattgttgcacgtg
ttcatccagcacacgtcggccagcctgacgctcaacgagaacgccagtccggaggtgcgg
gccgatttcgagcgatacttcagccgggcggtgcccgacggcgcgccctattttgcacac
acgctggaaggtcccgacgacatgcccgcgcacatcaaggcatcgctgttggggagcagt
ctgctgctgccggtgcgtgacggacggctggcgctgggcacctggcaggggatctacctg
tgcgagcaccgcaaccacggcggccctcgccgtctggtgctgacgctctggggagaggaa
gggtag

DBGET integrated database retrieval system