KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0979Help
Entry
Rhom172_0979      CDS       T01606                                 

Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rhom172_0979
Enzymes [BR:rmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Rhom172_0979
Exosome [BR:rmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rhom172_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1106430..1108295)
Genome map
AA seq 621 aa AA seqDB search
MSWLTEEDIRRWESGTFYDSYRKLGAHPDDEGTWFCVWAPHADGVSVLGAFNDWNPEANP
LERYGGGLWAGYVPGARPGHTYKYRIRHGFYQADKTDPYAFAMEPPTGSPIEGLASIITR
LDYTWHDDEWMQRRKGPASLYEPVSIYEVHLGSWRHKRPGESFSYREIAEPLADYVQEMG
FTHVELLPVMEHPYYGSWGYQVVGYYAPTFRYGSPQDLMYLIDYLHQRGIGVLLDWVPSH
FAADPQGLVFFDGTTLFEYDDPKMRYHPDWGTYVFDYNKPGVRNFLISNALFWLEKYHVD
GLRVDAVASMLYRDYSRKEWTPNIFGGRENLEAIDFIKRFNETVYLHFPEAMTIAEESTA
WPGVSAPTYNNGLGFLYKWNMGWMHDTLDYIRRDPIYRKYHHDELTFSLWYAFSEHYVLP
LSHDEVVHGKGSLWGKMPGDDWQKAANLRLLFGHMWGHPGKKLLFMGGEFGQHHEWNHDT
QLEWHLLDQPYHRGIQLWVRDLNHLYRTNPALWHDGPEGFEWIDFSDRDQSVICYLRRNA
GRMLLFVLNFTPVPREHYRVGVPIGGPWREVLNSDAVAYGGSGMGNLGRVEAVPESWHGR
PFHLELTLPPLAALILEPEHG
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgagctggctcacggaagaagacatccggcgctgggaaagcggcacattctacgacagc
taccggaagctgggcgcccatcccgacgacgaaggcacctggttctgcgtctgggcgccg
catgccgacggtgtctcggtgctcggcgccttcaacgactggaatccggaggccaacccg
ctggagcgctacggcggcggcctgtgggccggctacgtaccgggagcgcgcccgggccat
acgtacaagtaccggatccggcacggcttctaccaggccgacaagacggacccctacgcc
ttcgccatggagccgcccaccggcagccccatcgaagggctggcctccatcatcacgcgg
ctcgactacacctggcacgacgacgaatggatgcagcgccgtaaaggtccggccagcctc
tacgagccggtttccatctacgaggtccatctgggctcctggcgccacaaacgacccggc
gagtctttctcctaccgggagattgccgagccgctggccgactacgtgcaggagatgggc
ttcacgcatgtggagctgctgcccgtcatggaacatccctactacggttcctggggctat
caggtggtcggctactacgccccgacgtttcgctacggctcgcctcaggacctgatgtac
ctgatcgactacctgcaccagcgcggcatcggcgtccttctcgactgggtcccgagccac
tttgcagccgatccccagggcctggttttcttcgacgggaccacgctcttcgaatacgac
gatcccaagatgcgctatcaccccgactggggcacctacgtgttcgactacaacaaaccg
ggcgtgcgcaattttctgatctccaacgcgctgttctggctcgaaaagtaccacgtcgac
gggctgcgcgtcgatgcggtggcctccatgctctaccgggactactcacgtaaggagtgg
acgcccaacatcttcggcggccgcgaaaacctggaagccattgatttcatcaagcgattc
aacgagacggtctacctgcacttccccgaggccatgacgatcgccgaggaatcgacggcc
tggcccggcgtgtcggcccccacctacaacaacgggctgggctttctctacaagtggaac
atgggctggatgcacgacacgctggactacatccggcgcgaccccatctatcgcaagtat
caccacgacgagctgaccttctcgctctggtacgccttttcggagcattacgtcctgccg
ctctcccacgacgaggtggtgcacggcaagggctcgctctggggcaaaatgcccggcgac
gactggcagaaagcggccaatctgcgcctgctctttggtcacatgtggggccatccgggt
aaaaaactgctcttcatgggcggtgaattcggccagcaccatgaatggaaccacgatacg
cagctcgaatggcacctgctggaccagccctaccatcggggcattcagctatgggtgcgc
gatctgaaccacctctaccgtacgaatccggccctctggcacgacggaccggaagggttc
gagtggatcgacttcagcgaccgtgaccagagcgtgatctgctacctgcgtaggaatgcc
ggccgcatgctgctgttcgtactgaacttcacgcctgtgccacgtgagcactaccgcgtg
ggcgtgccgatcggcggcccctggcgcgaggtgctcaacagcgacgcggtggcctacggc
ggaagcggaatgggcaacttgggccgcgtcgaggcggtgcccgagtcctggcacggccgc
cccttccacttagagctgacgcttcccccgctggccgccctcatcctggagccggaacac
gggtag

DBGET integrated database retrieval system