KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0982Help
Entry
Rhom172_0982      CDS       T01606                                 

Definition
(GenBank) Cupin 2 conserved barrel domain protein
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AEN72912
UniProt: G2SG12
Position
complement(1111568..1112041)
Genome map
AA seq 157 aa AA seqDB search
MAEIHTLPATLRRFQATDEGFRWETVPLKHYKPEGTHFRDITRQVLFGPESGLPAELRYF
EVEPGGYSTFERHEHVHAVLILRGRGRAIVGEQLFEVQPFDLIHVPAWTWHQFQAAEDEA
LGFLCMVAVDRDRPTRPTPEEAEQLRRHPVIGPHLRL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaattcacacgcttcctgccacgttgcggcgctttcaggcaaccgacgaaggg
tttcgctgggagacggtgccactgaagcactacaagccggaaggcacgcacttccgggac
atcacgcgccaggtgctgttcggaccggaaagtggcctgcccgccgagctacgctacttc
gaagtggagccgggcgggtactccaccttcgagcggcatgaacacgtgcacgccgtgctg
atcctgcgcggacgggggcgtgccatcgtgggcgagcagctcttcgaagtgcagccgttc
gatctgattcacgtgccggcctggacctggcaccagtttcaggctgccgaagacgaagcc
ctgggctttctgtgcatggtagcggtggaccgtgaccgcccgacacgtcccacccctgaa
gaagccgagcaactccgtcgccacccggtcatcggccctcacttgcggctgtaa

DBGET integrated database retrieval system