KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0988Help
Entry
Rhom172_0988      CDS       T01606                                 

Definition
(GenBank) 20S proteasome A and B subunits
  KO
K01419  
ATP-dependent HslUV protease, peptidase subunit HslV [EC:3.4.25.2]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.2  HslU---HslV peptidase
     Rhom172_0988
Peptidases [BR:rmg01002]
 Threonine Peptidases
  Family T1: proteasome family
   Rhom172_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1117406..1117957)
Genome map
AA seq 183 aa AA seqDB search
MPHRHIHGTTVLGVRHNGRVALGADGQATLGNTVMKRRAQKVRALYNGKILAGFAGATAD
ALTLFERFEGKLQQHGGNVLRAAVELAKDWRTDRYLRRLDALLAVASPDRLLLISGNGDL
IEPDDDIVAIGSGGPFALAAARALRKHRPDLSARAIVEEALSIAADICIYTNHEFTILEI
DSK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgccccaccggcacattcacggtaccacggtactgggcgtacgccataacggccgcgtg
gccctgggcgccgacggacaggccacgctgggcaacacggtcatgaagcgccgcgcccag
aaagtccgggcgctctacaacggcaagatcctggccggctttgccggcgccaccgccgat
gccctgacgcttttcgaacgcttcgaaggcaagctgcaacaacacggcggcaacgtgctc
cgcgcggccgttgagctggccaaagactggcgcaccgaccgctacctgcgtcgcctggac
gccctgctggccgtcgcctcgcccgaccgcctgctgctcatcagcggcaacggcgacctg
atcgaacccgacgacgacatcgtggccatcggctccggcggacccttcgcgctggcggct
gcccgtgccctccgcaaacaccgccccgacctgtcggcccgcgccatcgtcgaagaggcc
ctctccatcgcggccgacatctgcatctacaccaaccacgagttcacgattctggagatt
gattcgaaataa

DBGET integrated database retrieval system