KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0989Help
Entry
Rhom172_0989      CDS       T01606                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  
serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rhom172_0989
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Rhom172_0989
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Rhom172_0989
Peptidases [BR:rmg01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Rhom172_0989
Peptidoglycan biosynthesis and degradation proteins [BR:rmg01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Rhom172_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1118027..1119520)
Genome map
AA seq 497 aa AA seqDB search
MRLRIWPILLLLWTLPAPVHAQSPRPLQATLDRVLDDPAYETAFWGALVLDLRDSTVLYA
RHARQNFTPASVTKLFITAAALEQLGPDFRYVTRLLADGPVVDGVLQGNLIVRGAGDPAI
GGRFTDGDRTATFRAWADSLRRRGIHRIAGGLIGDDDYFDDTPLGTGWSWDDLTYWYAAE
ISALSFNDNCVDVTIEARRPGEPGRLTWEPPTTYVTLINQTYTTPAGQQLKEGYRRLPGT
NTIVLFSRVPEGRRDTESLTVHNPTRYFVHVLREVLLAEGIAVEGQPVDVDELSTKPDYT
APNLWTVATYTSPPLSEIVRVINRRSQNLYAEMLLRTLGAERPVPDSTLAPGSAEMGLAA
AARTWLRAGIDTSRVQLVDGSGLSAQNLVSPEATVRLLAYMAAHPDRAVWRAFYASLPTG
GEEATTLQNRFRAGRARGNVRAKTGTISNTSALAGYVRTAGGRLLAFAIFCNHYTVPTRQ
VRRTIDAFVEHLARSRS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcgaatctggccgatcctgctgttgctgtggaccttgccggcgccggtccat
gcccagtcgccccggccgctgcaggcgacgctggatcgggtgcttgacgacccagcctac
gagacggccttctggggcgcgctcgtgctggacctgcgcgacagcaccgtgctctacgcc
cgccacgcccgccagaacttcaccccggcctccgtcaccaagctgttcatcacagcggcg
gcgctggagcaactcggccccgacttccgctacgtgacccgcctgctggccgacggtccc
gtcgtggacggcgtgctgcagggcaacctgatcgtccgtggcgcgggcgaccccgccatc
ggcggccgcttcaccgacggggaccgcacggccacattccgcgcctgggccgactcgctg
cgccgccggggcatccaccggatcgccggcggcctcatcggcgacgacgattacttcgac
gacacgccgctgggcacgggctggagctgggacgacctgacctactggtacgccgccgag
atcagcgcactgtcgttcaacgacaactgcgtggacgtcacgatcgaagcgcgccgcccg
ggcgaaccgggtcgcctgacgtgggagcctcccaccacttacgtcacgctgatcaaccag
acctatacgactcccgccggacagcagctgaaagaaggctatcgccgcctgcccggcacc
aacacgatcgtgctcttcagccgcgtgcccgaaggccgccgcgacaccgagtcgctcacg
gtccacaacccgacgcgctacttcgtgcacgtgctgcgtgaggtgctgctggccgaaggc
atcgccgtcgaaggacaacccgtggacgtggacgaactttcgaccaaacccgactacacc
gctccgaacctgtggacggtggccacctacacctcgccgccgctttcggagatcgtccgg
gtcatcaaccggcggagccagaacctgtacgccgaaatgctgctgcgcacgctgggggcc
gaacggccggtgcccgacagcacgctcgcacccggatcggccgaaatgggtctggcggcc
gccgcccgcacctggctccgtgccggcatcgatacgagccgtgttcagctggtggacggc
tccggcctctcggcccagaacctggtctcgcccgaggccaccgtacgcctgctagcctac
atggccgcccatcccgatcgcgcggtctggcgggcgttctatgcgtcgctccccaccggc
ggcgaagaagcgaccacattgcagaatcgattccgtgccggacgcgcccgtggcaacgtc
cgcgccaagaccggcacgatctcgaacacgagcgccctggcgggatacgtgcgcaccgcc
ggcggccgcctgctcgcctttgccattttctgcaatcactacaccgtccccacccgacag
gtccgccgcaccatcgacgcctttgtcgagcacctggcccgctcccgcagctga

DBGET integrated database retrieval system