KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0992Help
Entry
Rhom172_0992      CDS       T01606                                 

Definition
(GenBank) Bifunctional purine biosynthesis protein purH
  KO
K00602  
phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rhom172_0992
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rhom172_0992
Enzymes [BR:rmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     Rhom172_0992
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     Rhom172_0992
Exosome [BR:rmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rhom172_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1121526..1123124)
Genome map
AA seq 532 aa AA seqDB search
MLHQPRTHEPPPDLQPVRRALLSVFDKTGLVDFARRLAALGVELISTGGTARTLREAELT
VRDVSELTGFPEILDGRVKTLHPAVHGGLLARRNVPEDLAQLERHGIAPIDLVVVNLYPF
EQAVEQAPDDEALAVENIDIGGPTLIRAAAKNFFFTAVVVDPSDYDAIAEELTQHAGALT
LATRRRLAQKAFARTAAYDRAIAAYLERRLQPEAPEPLPPRLQIGLPRVQILRYGENPHQ
RAALYGNPDRFFRQLHGKALSFNNLLDLSAALRLIDEFREADPTCAILKHTNPCGVATAD
TLAEAYARAFATDRRSPFGGIVVVNRPLDRETAEAIDQIFTEVIIAPDFEEGVLDFLKKK
ANRRIIQQLRPVQEELDVRSAVGGLLVQEPDGPLPPLEVLRLSWRVVTRRAPTEAEWRDL
DFAWRVVKHVKSNAIVYARDRATLGIGAGQMSRVDASEIAVLKGKREGHDFTGSVVASDA
FFPFADGVLAAVESGARAVIQPGGSIRDEEVIQAADAHDVAMVFTGTRHFRH
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcaaccgcgcacccacgagccgcctccggacctgcaacccgtccggcgggcg
ctgctgtcggtgttcgacaaaaccggcctagttgatttcgcccgtcgtctggcggcgctg
ggcgtcgagctgatctccacgggcggcacggcccgtacgctgcgcgaggccgaactgacc
gtgcgcgacgtctcggagctgactggctttccggaaatcctcgacggccgcgtcaaaacg
ctgcacccggccgtccacggcggcctgctggcccgtcgcaacgtacccgaagacctggcc
cagctcgagcggcacggcatcgcccccatcgacctggtggtggtcaacctgtatcccttc
gagcaggccgtcgagcaggcacccgacgacgaagcgctggccgtcgaaaacatcgacatc
ggcggccccacgctcattcgcgccgccgccaagaactttttcttcacggccgtggtggtc
gatccgtccgactacgacgccatcgccgaggagctgacccagcatgcaggcgcattgacg
ctggccacgcgccgccgcctggcccagaaggcttttgcccggacggccgcctacgaccgg
gccatcgccgcctatctggagcgccgcctgcagcccgaagcaccggagccgctgccgccc
cggctgcagatcggcctgccgcgcgttcagatcctgcgctacggcgaaaatccccaccag
cgggcggctctctacggcaacccggatcggttcttccgccagctccacggcaaggcgctc
tccttcaacaacctgctggacctgagcgcggcattgcggctgatcgacgagttccgggag
gccgaccccacctgcgccatcctgaagcacacgaacccgtgcggcgtggccacggccgac
acgctcgccgaagcctacgcgcgcgccttcgccaccgaccggcgctcgccctttggcggg
atcgtggtggtcaaccgaccgctcgaccgcgagacggccgaggccatcgatcagattttc
accgaagtgatcatcgcaccggacttcgaggaaggcgtgctggactttctgaaaaagaag
gccaaccgccgcatcatccagcagctccgtcccgtgcaggaagaactggacgtgcgctcg
gccgtgggcgggttgctggtgcaggagcccgacggtcccctgccgccgctggaggtgctg
cgcttgtcctggcgcgtggtgacccgccgtgcccccaccgaggcggagtggcgcgacctg
gacttcgcctggcgcgtggtcaaacatgtgaagagcaacgccatcgtgtacgcgcgcgac
cgggccacgctgggcatcggagccggccagatgagccgggtggacgcctccgagatcgcc
gtgctcaaagggaaacgcgaagggcacgattttaccgggagcgtggtggcctccgacgcc
tttttcccctttgccgacggggtgctcgccgccgtcgaaagcggcgcgcgcgccgtaatc
cagccgggcggctccatccgggacgaagaggtgatccaggcggccgacgcgcacgacgtg
gccatggtcttcaccggcacccggcacttccgccactga

DBGET integrated database retrieval system