KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0999Help
Entry
Rhom172_0999      CDS       T01606                                 

Definition
(GenBank) Cysteine desulfurase
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1128153..1129295
Genome map
AA seq 380 aa AA seqDB search
MDDRKLRALRRRFPHTQTQIYLNHAATGPLSRPVVQAVRRYLQQRYLGPIDNYEELAPII
DETRRLVATVLGTTPDRIAFAPNTSSALGLLAQGLDWKPGDRIAIPACEFPANVYPFMNL
QHRGVQVDWIPHREGTFTVEDVARVLTPRTRLVTLSWVQFLSGFRADLTQIVACCHERGV
WVSVDAIQGLGALPLDVEATGIDLLAAGTHKWLMGLQGLAVCYVRPVLQEVLRPPAGWLH
GPVDWNRFFDYRLEFYPDARRYETGTPNQAAIVALHAALKQYLALGVDWCARRVLTLQRR
LAEGLRRLGLACYGTDDPAHASGIVTVRHPRAEALAAFLKAQRIIASVRNGMLRFSPTYY
NTAEEIDRTLETVAEGLRRI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccggaaactgcgcgcgctgcgccgtcgctttccgcacacgcagacgcagatc
tacctgaaccatgccgccacggggccgctcagccgtccggtggtgcaggccgttcggcgc
tacctgcagcagcggtacctggggccgatcgacaattacgaggagctggcgccgatcatc
gacgagacgcgccggctcgtggccacggtgctgggtacgacgcccgaccgcattgccttt
gcgccgaacacttcctcggcactgggactgctggcgcagggactcgactggaagccgggc
gaccgaattgccatcccggcctgcgagtttccggccaacgtctatccgtttatgaacctg
cagcatcggggtgtgcaggtcgactggattccgcatcgggaagggacgttcaccgtcgag
gacgtggcgcgggtactcaccccgcgcacccggctggtaacgctgagctgggtgcagttc
ctttcgggattccgggccgatctgacgcagatcgtcgcctgctgtcacgagcgcggcgtc
tgggtcagcgtcgatgccattcaggggctgggggcgttgccgctcgatgtggaggcgacc
ggcatcgacttgctggcggcgggcacgcacaagtggctgatgggcttgcaggggctggcg
gtctgctacgtccgacccgtgttgcaggaagtgcttcgtccgccagccggctggctgcac
ggcccggtggactggaatcgatttttcgactatcggctggaattctacccggacgcccgg
cgctacgagacgggcacgcccaaccaggcggccatcgtggcgctgcatgccgcgttgaag
cagtacctggcgctcggagtggactggtgcgcgcgtcgggtgctgacgttgcaacggcga
ctggccgaggggctccggcggttgggactggcatgctacggcaccgacgatccggcgcac
gcctccgggatcgtgaccgtgcgacatccgcgggccgaggcgctggcggcatttctcaaa
gcgcagcggatcatcgcttcggtgcgcaacggcatgttgcgcttttcgcccacctattac
aacacggccgaagaaatagaccgcacgctggagacggtggccgaagggctgcggcggata
taa

DBGET integrated database retrieval system