KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1005Help
Entry
Rhom172_1005      CDS       T01606                                 

Definition
(GenBank) putative signal transduction histidine kinase
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1140283..1141542
Genome map
AA seq 419 aa AA seqDB search
MTEPCRSCNRSDLLKIQAFQFRVFTVKRKYMAALHEAESAGAGFLRRRWVEVLVIWLFWT
FLAVLVATGKLLDPRWAGQEASLVRRQVLHIFSEFYTWALLTPGIFWLSRRLAFDRPQWV
GRLLLLLGIGLAVALLMEIWVDFLYLYVYQLPWRRGRFDLLEGIRHFWFINDLVTFFAVL
AAGFARDYFLRYQQRQQEAAQLRAQAADLQARLTEARLQALRMQLNPHFLFNTLHAISAL
VERDPKGVRHMIARLSELLRYTLDEGGAQEVPLAQELRFMEGYLDIQQIRFQGRLEVEQE
IDPDVLEALVPNLILQPIVENAIKHGVSRLETTGRITLRAWREGDQLWLCVRDNGPGLSG
DGQWQEGLGLRNTRARLEGLYGDAYRMELRQPPEGGVEVCIRLPYHTAADPHVSAHADA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgacagagccgtgccgttcatgcaaccggagcgaccttttgaaaatccaggcgtttcag
ttccgggtattcacagtgaaacggaaatacatggccgccttgcacgaagcagaaagcgcc
ggcgcaggattcctgcggcgacgctgggtagaggtgctggtgatctggctgttctggacg
tttctggcggtgctggtggcgacgggtaaactgctcgatccccgctgggccggacaggaa
gcgtcgctggtgcgccggcaggtcctgcacatcttttcggaattttacacctgggcgttg
ctgacgccgggcatcttctggctgagtcgccgactggccttcgatcgtccccaatgggtc
ggtcgcttgctgctcctgctggggatcggactggccgtggcgctgctgatggagatctgg
gtggactttctctacctctacgtctatcaattgccctggcggcgtgggcggttcgacctg
ctggaaggcattcgccacttctggttcatcaacgacctggtgaccttcttcgccgtgctg
gcggccggctttgcccgggactacttcctccggtaccagcagcgccagcaggaggccgcc
cagctccgggcgcaggcggccgacctgcaggcgcgcctgaccgaagcccggctgcaggcg
ctgcgcatgcagctcaacccgcactttctgttcaacacgctgcacgccatctcggcgctg
gttgagcgcgacccgaagggcgtgcggcacatgatcgcgcgcctgagcgagctcttgcgc
tacacgctcgacgaaggcggggcgcaggaggtgccgctggcccaggagctgcgctttatg
gagggctacctcgacatccagcagatccgctttcaggggcggctggaggtggagcaggaa
atcgacccggacgtgctcgaggcgctggtgccgaatctgatcctgcaacccatcgtggaa
aacgccatcaagcacggcgtaagccgccttgaaacgaccggccgcatcacgctgcgcgcc
tggcgtgaaggcgatcagctctggctgtgcgtgcgcgacaacggcccgggcctctccggc
gatggacagtggcaggaagggctggggctgcgcaacacccgggcccgcctggagggactc
tacggcgacgcctatcggatggaactgcgtcagcccccggagggcggcgtggaagtctgc
attcgtttgccgtatcatacggcagccgacccgcacgtgagcgcccatgccgacgcctga

DBGET integrated database retrieval system