KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1006Help
Entry
Rhom172_1006      CDS       T01606                                 

Definition
(GenBank) two component transcriptional regulator, LytTR family
  KO
K02477  
two-component system, LytTR family, response regulator
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
Two-component system [BR:rmg02022]
 LytTR family
  Unclassified
   Rhom172_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1141529..1142329
Genome map
AA seq 266 aa AA seqDB search
MPTPDRPLRVLIVDDEPLARQRLLDLLEGRADIEVAGQATSGREAVEAIRALQPDLVFLD
VQMPGMTGLDVVREIGPEHMPVTIFVTAYDQYALKAFEVAAIDYLLKPFDDERFEQALER
ARRLLKLREVEALRERLLQLLQDDRPAAPPNPSKYLERIAVEMRGQVRVIPVRQIDYITA
SGPYAELHVGDQVYVIREQMQMLEERLDPELFIRIHRSAIVRIDLIDVLLRGAGGRYAVR
LKNGVRLKVSRSRREALERRLGLQAG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgcctgatcgtccgctgcgtgtcctgatcgtcgacgacgagccgctggcccgc
cagcgcctgctggacctgctcgaaggccgcgcggacatcgaagtggccggacaggccaca
agcggtcgggaggccgtcgaagccattcgcgcgctgcaacccgacctggtcttcctcgac
gtccagatgccgggcatgaccgggctcgacgtggtgcgcgagatcggtcccgagcacatg
cccgtgaccatcttcgtaacggcctacgatcagtatgcactgaaggccttcgaggtggcg
gccatcgactacctgctcaaacccttcgacgacgaacgcttcgaacaggcgctggagcgc
gcccgccgcctgttgaaactccgggaagtggaggcgctgcgcgagcgtctgctgcaactt
ctgcaggacgaccggcctgcggcgccgccgaacccttcgaaatacctggaacgcattgcc
gtcgagatgcgcggccaggtgcgcgtcattccggtccgacagatcgactacatcacggcc
agcggaccctatgccgagctgcacgtgggcgatcaggtgtacgtgatccgcgagcagatg
cagatgctcgaagagcggctcgatccggagctgttcatccggatccaccgctccgccatt
gtgcggatcgacctgatcgacgtgctgctgcgcggggccggcggtcgctatgccgtgcgt
ctgaaaaacggcgtgcgcctgaaggtcagccgcagccgccgcgaagcgctggagcgccgg
ctgggcctgcaggccgggtga

DBGET integrated database retrieval system