KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1009Help
Entry
Rhom172_1009      CDS       T01606                                 

Definition
(GenBank) natural resistance-associated macrophage protein
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1145974..1147266)
Genome map
AA seq 430 aa AA seqDB search
MRRWTSILLGAVLTAAFIGPGTVTTAAAAGAGYGLALLWALTFSTLACWTLQEAAARLAI
CSGRPLAEALRHQFGGWKGVAVRLLVLGAIVLGNAAFEVGNVLGAVAGLELVFDAPRRLL
VLGVGVLSGILLWFGTLRMLPRVLGAFVAFMGLAFLVTALRVHPPDATLLRHLVWPAQPE
GAGLLVVGLIGTTVVPYNLFLGSGLARDEPLDATRFGLAVAIVGGGLISMAVLVVGTAVH
GAFTYEALAETLGRTLGAWARTLFALGLFAAGFTSALTAPIAAAITARGLLRAPNASAHD
RTYRITWLVVWSSGMLLSLLDLRPIPAFITAQALNGVLLPIVAVFLWIATNDPRLMGRDG
LTSPGLNVLAGLSVGVAVLLGLRNLLAALQAAGMGPALSESLLLKLAGGITFFLLLLLSR
YLYRLRRPAP
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgctggacctccatcctgctcggggccgtcctgacggcggccttcatcggtccg
ggcacggtcaccacggcagcggccgccggggccggctacgggctggccctgctctgggca
ctgacgttctcgacgttggcctgctggacgctgcaggaggcggccgcccggctggccatc
tgctcgggacgtcccctggccgaagcgctgcgacatcagttcggtggctggaaaggcgtg
gccgtccgattgctggtgctgggcgccatcgtgctgggcaatgcggctttcgaggtaggc
aacgtgctgggcgccgtggccggactggagctggtgttcgacgcacctcgccgcctgctg
gtactcggcgtgggtgtgctctccggcatcctgctctggttcggtacgctgcgcatgctg
ccgcgcgtgctcggtgccttcgtggcgttcatgggcctggcgtttctggtcaccgcgctg
cgggtgcatccgcccgacgccacactgctgcgccatctggtctggcccgcgcagccggaa
ggtgccggcctgctggtggtggggttgatcggcacgaccgtcgtgccctacaacctgttt
ctgggctccgggctggcccgggacgaaccgctggatgcgacgcgcttcgggctggccgtg
gccatcgtcggcggcggcctcatctcgatggccgtgctcgtcgtcggcacggcggtgcac
ggcgcgttcacctacgaggcgctcgccgaaacgctcggccggacgctgggcgcctgggcc
cgcacgctgttcgcactgggactctttgcggccggcttcacctcggcactgacggcgccc
attgccgccgccatcacggcccggggcctgctgcgcgcaccgaacgcttcggcgcacgac
cgcacctatcggatcacctggctggtggtgtggagcagcggtatgctgctgagtctgctg
gacctgcgcccgattccggccttcatcacggcccaggcgctcaacggcgtgttgctgccg
atcgtggccgtattcctgtggatcgccaccaacgatccgcgactgatgggccgcgacggc
ctcacatcgcccgggctgaacgtgctggccgggctttcagttggcgtggctgtcctgctg
ggcctgcgcaacctgctggccgcgttgcaggcggcgggcatgggtccggccctctccgaa
tcgctgctgctgaaactggccggcggcattactttctttctgctactgcttctgagtcgc
tatctgtaccgattgcgtcgtcctgccccatga

DBGET integrated database retrieval system