KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1011Help
Entry
Rhom172_1011      CDS       T01606                                 

Definition
(GenBank) Amidase
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1149019..1150719
Genome map
AA seq 566 aa AA seqDB search
MPLDRRLFLQYCSALGLTGTLFPGVLYAKIEEGEPITPETIACAERIAGLSFTEEQRQMM
VEDLTERLKDYEALRQVPLPNDVIPAFVFDPTIGGEPIPEGTAGMRWEPRPVERPRSDED
LAFMTVAELSYLLKTRQVRSVELTELYLARLKRYDPVLKAVITYTEERAMAQAQQADEEL
DAGHWRGPLHGVPYGAKDLLAVPGYRTTWGAKPYENQVLDVTAAVIEKLDAAGAVLVAKL
TLGALAWGDVWFGGQTKNPWNIEQGSSGSSAGPGAAVAAGLVPFAIGSETLGSIVSPSTR
NGVTGHRPTFGAVSRYGAMTLAWTMDKLGPMARSAEDCALVFDVIRGRDPRDPSTRDMPF
PFDPTFDVRQLRVGYLAEAFEADYENREADRQTLQVLRELGIDLKPIRLPDDLPVSAMLM
TLEVEAAAAFDELTRTGGVDQMVRQGRNTWPHVFRVARFVPAVEFLQANRIRTLLMQRMA
EVFREVDVFVSPTFGGGTLQITNLTGHPCVCVPNAFHPLKDNPLSPRRRPGSITFIGGLY
RDAEVLMLAHAYQQATDFHRRRPPIR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggatcgtcgcctgtttctccagtactgctcggcgctgggactgaccggtacg
cttttccccggcgtgctgtatgcgaaaatcgaagaaggcgagccgatcacgccggagaca
atcgcctgtgccgaacgcatcgccggcctgtcttttacggaagaacagcgccagatgatg
gtggaggacctgaccgagcgcctgaaggactacgaggcgctgcgtcaggtcccgcttccc
aacgacgtcattccggccttcgtgttcgatccgaccatcggcggcgaaccgattccggaa
ggaacggccgggatgcgctgggagccccgaccggtggagcgaccgcgcagcgacgaagac
ctggccttcatgacggtggccgagctttcgtacctgctcaagacgcggcaggtgcgctcg
gtggagctgaccgaactgtacctggcccgcctgaagcgctacgatcccgtgctgaaggcc
gtcatcacctacaccgaagaacgggcgatggcgcaggcgcagcaggctgacgaggagctg
gacgccggccactggcgggggccgctgcacggcgtaccctacggggccaaggatctgctg
gccgtgcccggctaccgcacgacctggggcgcgaaaccctacgaaaaccaggtgctggat
gtgacggccgccgtgatcgaaaagctggatgcggccggcgccgtgctcgtggccaagctg
acgctgggggcgctggcctggggcgacgtgtggttcggcggccagacgaaaaacccctgg
aacatcgagcagggatcgagcggctcttcagcaggtcccggtgcagcggtggcagccgga
ttggtaccgttcgcgatcggctcggagacgctgggctcgatcgtgtcgccctcgacgcgg
aacggcgtgaccggccatcgtccgacgttcggggcggtgagccgctacggggccatgacg
ctggcctggacgatggacaagctcggccccatggcccgttcggccgaggattgcgcgctc
gtgttcgatgtgatccgggggcgcgacccgcgcgatccgagcacgcgcgacatgccgttt
ccttttgatccaaccttcgatgtgcgacagctccgcgtgggttatctggccgaggccttc
gaagcagactatgaaaaccgagaggccgatcgccagacgctgcaggtgctgcgtgagctg
ggcatcgacctgaagccgatccgtctgcctgacgacctgcctgtatcggctatgctgatg
acgctggaggtagaggcagcggctgcttttgacgagctgacccgcaccggaggggtcgat
cagatggttcggcagggacgcaatacctggcctcatgtgttccgcgtggcccgctttgtg
ccggcggttgagtttctgcaggctaaccgcattcgcacgctgctcatgcagcgcatggcc
gaggttttccgcgaggtggacgtgttcgtttcgccgacgttcggcggagggacgctccag
atcacgaacctgacaggtcatccctgcgtgtgcgtaccgaacgccttccatccgctgaaa
gacaacccgctgtcgccgcgtcgccggcccggcagcatcacgtttatcggcggcctgtac
cgggatgccgaggtgctcatgctggcccatgcctaccagcaggccaccgattttcaccgg
cgccgcccgccgattcgctga

DBGET integrated database retrieval system