KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1019Help
Entry
Rhom172_1019      CDS       T01606                                 

Definition
(GenBank) Endo-1,4-beta-xylanase
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1166222..1167718
Genome map
AA seq 498 aa AA seqDB search
MCATQSSSRGGWLGRLCRVTWAFQLGLLLLGNAPVIAQSWRAAALQRIEQYRKGTIRVQV
LDPDGRPVEGAQVHVRMRRHAFGFGTAVSFGLVLGPNAHPVYRAKLEDLTGDGRTFNMAT
PENALKWPWWEAERPIPNAQKIEVIDWLRALGYEIRGHNLLWPDWRWLPQDVAAHRDDPA
YIHDRVRRHIAAVAGHPGLRGKLRDWDVLNEPAHLTALRDVFDGWGPYRQGEDFYVDVFR
WAKAADSSARLFINEFNIINNYANEEATRAYYKQIIAELLAQGAPLEGIGIQSHFTVPLP
SMTEVKAALDSLAAFGLPLSITEYDVRGASEQAEASFMEDFLTMVFSHPAVESFIMWGFW
DGAHWRDDAPLFREDWTLKPSGKVFLDLVFNRWWTDTTGVTGPDGSWTVRGFLGDYEVTV
RHEDLRADREMSLRSRSDTSRVTVVLGATGELMRSRPKGSKPEVVPGDGTPVRSRRDRVA
AAGLSRPGPLRLYLNSGN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcaacgcaatcgagttcacggggtggctggctcgggaggctgtgccgggtaacc
tgggcctttcagcttggcctgctgttgctgggaaatgctccggtgatcgcacagagctgg
cgagcagccgcactgcaacgcatcgaacagtatcgcaaaggcacgatccgggtgcaggtg
ctcgaccctgatggacggccggtagaaggcgcgcaggtacacgtgcggatgcgccggcat
gccttcgggttcgggacggcggtcagttttggactggtgctggggcccaatgcccaccct
gtctatcgcgccaaactcgaagatctgaccggcgatggccgtacgttcaacatggccacg
ccggaaaatgcgttgaaatggccctggtgggaagcggagcgcccgatccccaatgcgcag
aaaatcgaagtaatcgactggctacgtgcgctgggttatgaaatccgcgggcacaatctg
ctctggccggactggcgctggttgccacaggacgttgcggcacaccgcgacgatcccgcc
tatatccacgatcgggtccggcgccacatcgcagccgtggccggtcacccggggcttcgc
ggcaaactgcgcgactgggatgtgctcaacgaaccggcacacctgaccgcgcttcgcgat
gtatttgacggatgggggccgtaccgacagggcgaggacttctacgtggatgtttttcgc
tgggcaaaagccgccgattcttcggcgcggcttttcatcaacgaattcaacattatcaac
aactacgccaacgaagaggcaacgcgcgcctactacaaacagatcatcgcagaattgctg
gcacagggtgctccgctggaaggcatcggaatccagagccactttacggtaccgttgccg
agcatgaccgaggtcaaggcggcgctcgattctctggcggccttcgggttaccgctttcc
atcacagaatatgacgtgcggggcgcctccgagcaggcggaagcttcgttcatggaggat
tttctgacgatggtcttcagccatccggccgtcgagagctttatcatgtgggggttctgg
gatggcgcgcactggcgcgacgacgcccccctgttccgagaagactggacgctgaagcct
tcaggcaaggtcttccttgatctggttttcaatcgctggtggaccgacacgaccggcgta
accggaccggatggctcctggacggttcggggatttctgggggattacgaagtgaccgta
cggcatgaagacctccgggcagaccgcgaaatgtcgcttcggagcaggtccgacacgtcc
agggtcacggtggtgctgggagcgaccggggagctgatgcgatctcgaccgaaggggagc
aaaccggaagtcgtgccgggagatggaacgcccgtgcggagcaggcgggatcgagtggct
gcagcaggcctgagccgtccgggaccgttgcggctgtacttaaatagcgggaactga

DBGET integrated database retrieval system