KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1020Help
Entry
Rhom172_1020      CDS       T01606                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
Transcription machinery [BR:rmg03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Rhom172_1020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1167759..1168322
Genome map
AA seq 187 aa AA seqDB search
MRPGASISEQQELAARVRQGDAVAFERLFRAYYTPLVHFAVHIVGTLPEAEEVVQRVFVN
IWRNRAAWAPHVSVAAYLYGAVRNEAVKYSQRRPPAVPLEEAAEMVCDRPHPDQQLVGND
LTELIERLIQELPEQRRLIFTLSRDHGLTYAEIAQSLGISIKTVETQMGRALRQLRERLQ
AWLNVAP
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgggcgcttctatttctgagcagcaggagctggcggcaagggtacgccagggc
gatgcggtagccttcgagcggctgtttcgggcctactacacgccgctggtgcactttgcc
gtgcacatcgtgggcacgctcccggaggccgaggaagtggtgcagcgcgtgttcgtcaac
atctggcgcaaccgggccgcctgggcgccccacgtctcggtagcggcctatctctacggc
gccgtgcgcaacgaagccgtcaaatacagccagcggcgtccgcccgccgtaccgctggaa
gaagcggccgagatggtctgcgaccgcccccacccggaccagcaactggtcggcaacgac
ctgaccgaactgatcgaacggctcatccaggagctgcccgagcagcgacggctgatcttc
accctctcgcgcgatcacgggctcacctacgccgaaattgcgcagtccctgggcatctcg
atcaagaccgtggaaacgcagatggggcgcgccctgcgtcagcttcgggagcgcctccag
gcgtggctgaacgttgcgccctga

DBGET integrated database retrieval system