KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1023Help
Entry
Rhom172_1023      CDS       T01606                                 

Definition
(GenBank) RagB/SusD domain-containing protein
  KO
K21572  
starch-binding outer membrane protein, SusD/RagB family
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
Transporters [BR:rmg02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   Rhom172_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1173003..1174532
Genome map
AA seq 509 aa AA seqDB search
MKTYLSMPTRWLLSLLLLVGLTGCGEGFLEEDPRTFVSTDMVLNTPEGLEGAVIALYDFP
TWLYHSTSYSYWFISGTDVTRVGPLHEDLGTALYNSDLNPQHPASREYWNQSYQTLYRAN
AIIAAAPNVDFDGDEARRNRVIAEARFFRAYILFYLHQRYGNIPLVTEPSETIREKEQPA
DPADIYRVIVDDLRFAIDNLAWTYDDQPGRITKGAAMHLLAKVYLVLQNWQQAAQTAETL
ILQGPYELLDDPAEIFADNNENNKEAIWTIQFDPQADNYGHFLAVMFTPLYDRIQGVART
FEQGGRPWARMYPSAYLLSLFDKNDRRLKAWYKTHWVYDDPDEGLPPGRQVGDTVRTSDF
NPPLDSMLYLHPACKKYWEYGATRDINQADSYKGIIRYRLAETYLIAAEAYMRLGDQAKA
LEYINPLRRRAGVPDLTELNEDILLEEHARELAFEQDRWFTLKRMGRLVQHVRQYNPDAA
PNIKDCHVNMPIPQEFVDLTGFPQNDCYR
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaagacatatctgtcgatgccaacccgctggctcctgagcctcctgctgctggtcgga
ttgaccgggtgcggtgagggctttctggaagaggatccgcgcacgtttgtcagtactgat
atggtactgaatactccggaaggtttggagggcgctgtcattgcactctacgatttccca
acctggctttatcatagcacgagctatagctactggttcatttctggaaccgatgtgacg
cgggtaggacctctacacgaagatttgggcacagcgctctacaatagcgatctgaacccg
caacatccggcttcgcgggaatactggaaccagtcgtaccagaccctctaccgcgccaat
gccattatcgccgcggctccgaacgtggacttcgacggcgacgaggcccggcgcaaccgg
gttatcgcggaggcccgtttcttccgagcctacatcctgttctatctccaccagcgctac
ggcaatatcccgctggtgaccgagccttcggagaccatccgcgagaaagaacaacccgcc
gatccggcagacatctaccgggtcattgtcgacgacctccggtttgccatcgacaatctg
gcatggacgtacgacgaccagcccggccggatcacgaagggcgcggccatgcacctgctg
gccaaggtctatctggtgctccagaactggcagcaggcagcccagacggccgaaacgctc
atcctgcaggggccctatgagctgctggacgacccggccgaaatctttgcggacaacaac
gaaaacaacaaagaggcgatctggaccattcagttcgatccgcaggccgacaactacggt
cattttctggccgtgatgttcacgccgctttacgaccgcattcagggcgtggcgcgtacc
ttcgagcagggcggccggccctgggcccgtatgtaccccagcgcctacctgctcagcctc
ttcgacaaaaacgaccggcggctgaaagcctggtacaagacgcactgggtctacgacgac
cccgacgaggggctgccgccgggccgtcaggtgggcgacacggtgcgtacctcggacttc
aacccgccgctggattcaatgctctacctgcatccggcctgcaagaagtactgggagtat
ggcgcaacccgcgatatcaaccaggccgactcctacaagggcatcatccgctatcgcctg
gccgaaacctacctgatcgccgccgaagcctacatgcgcctgggcgatcaggccaaagcg
ctcgaatacattaacccgctgaggcggcgggccggtgtacccgacctgaccgaactcaac
gaggacattctgctcgaagagcatgcccgcgaactggccttcgaacaggaccggtggttt
acactcaagcgcatgggacgcctggtgcagcacgtgcgccagtacaatccggatgcggca
cccaatatcaaagactgtcatgtaaacatgcccattccgcaggaatttgtggacctgacg
ggcttcccgcagaatgactgctatcgctga

DBGET integrated database retrieval system