KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1024Help
Entry
Rhom172_1024      CDS       T01606                                 

Definition
(GenBank) Alpha-glucuronidase
  KO
K01235  
alpha-glucuronidase [EC:3.2.1.139]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.139  alpha-glucuronidase
     Rhom172_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1174666..1176846
Genome map
AA seq 726 aa AA seqDB search
MRRLIFWMLLLAGAGFWSRPGVAEDGYQLWLRYVRIGDETLRQRYLEQLRALHLEATSPT
LEIVQEELRRGLQGLLGTSMPLVDRVEEGVLLVGTPASCPTIAALGLEAELQALGDEGFM
IRTMTVEGHRATVLAAAKDVGVLYGAFHLLRLLQTHRPIDSLNVREAPRVRLRVLNHWDN
LDRTVERGYAGFSLWDWFKLPDYIDPRYRDYARANASLGINGTVLTNVNADARVLLPEFL
EKVAALADIFRPYGIRVYLTARFSAPIEIGGLDTADPLDPDVRAWWRDKVAEIYRYIPDF
GGFLVKANSEGQPGPQDYGRTHADGANMLAEALAPYGGVVMWRAFVYAPEAEDRVKQAYD
EFVPLDGQFRENVLIQVKNGPLDFQPREPFHPLFGAMPRTPLMMEFQITKEYLGFSTHLA
YLGTLWEEVLQADTYARGESSTVARVIDGSLFGRELTGMAGVANIGTDRNWCGSIFDQAN
WYAFGRLAWNPDLRADSIAEEWIRMTFTNDPRFVAPVKQMMLESREAVVNYMTPLGLAHL
MGPGHHYGPAPWFDQAPRPDWNNTYYHRADTLGIGFDRTATGSNAVAQYFSPLREIFGSL
ERCPEKYLLWFHHVPWDYRMRSGRTLWEELVDHYYRGVETVRRWQPLWESLRAFVDPERF
EQIATLLRIQEKEAVWWRDACVLYFQTFSRRPIPAGYEQPAHTLDYYIELQRKLQRFPMP
GHWVGR
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcggttgattttctggatgctcctgctggcaggcgctggcttctggagccggccg
ggcgtggcggaagacggctatcagctctggttgcgctacgtgcgcatcggggacgaaacg
ctccggcaacgctacctggagcaactccgggcgcttcacctggaggccacgtcgcccaca
ctcgaaatcgttcaggaggagctccggcgcggcctgcagggactgctcggcacgtcgatg
ccattggtggaccgggtcgaagaaggggtgctgctggtcggcacaccggcttcttgcccg
accatcgcggcgctggggctggaggcggagctgcaggcgctgggcgacgaagggttcatg
atccgaaccatgacggtagaaggacaccgcgccacggtgctggccgctgcgaaggacgtg
ggcgtgctctacggtgcttttcatctgctgcgcctgcttcagacgcaccggccgatcgat
tcgctgaatgttcgcgaagcgccccgcgtgcggctgcgcgtgctcaaccactgggacaac
ctcgatcgcaccgtcgaacgcggctatgccggcttttcgctctgggactggttcaaactc
ccggactacatcgacccgcgctaccgcgactatgcccgcgccaacgcttcgctgggcatc
aacggcacggtgctgaccaacgtcaacgccgacgcgcgggtgcttttgccggaatttctg
gaaaaggtggcggcgctggccgacatcttccggccctacggtatccgggtgtacctgacg
gcgcgtttcagtgcccccatcgaaatcgggggactcgacacggccgatccgctcgatccc
gacgtccgggcctggtggcgggacaaggtggcggaaatctatcgctacatcccggacttc
gggggctttctggtgaaggccaactccgaaggccagccgggaccgcaggattacggccgc
acgcacgccgacggggccaacatgctggccgaagcgctcgcgccctacggcggcgtggtc
atgtggcgggcgttcgtctacgcaccggaggccgaagaccgggtcaagcaggcctacgac
gaatttgtgccgctggacggacagtttcgcgaaaacgtactgattcaggtcaaaaacggg
ccgctcgatttccagccgcgcgaaccgttccatccgcttttcggcgccatgccgcggacg
ccgctcatgatggaattccagatcaccaaagaatacctgggcttctcgacgcacctggcc
tatctgggaacgctgtgggaagaggtcctgcaggccgacacctacgcccggggcgaaagc
tcgacggtggcccgcgtgatcgacggcagcctcttcggccgcgagctgaccggcatggcc
ggcgtggccaacatcggcaccgaccgcaactggtgcggcagcatcttcgatcaggccaac
tggtatgccttcgggcgcctggcgtggaatccggacctgcgggccgactcgattgccgag
gagtggatccgcatgaccttcacgaacgacccgcgcttcgtcgcaccggtcaaacagatg
atgcttgagtcgcgcgaggccgtcgtcaactacatgacgccgcttggactggcccacctg
atgggtcccggccaccattacggcccggcgccctggttcgatcaggcgccacgtcccgac
tggaacaacacctattaccaccgggccgacacgctggggatcggcttcgaccggacggca
acaggcagcaacgcggtggcccagtacttttcacccctgcgggaaatttttggcagcctg
gagcgctgtccggaaaaatatctgctgtggtttcatcacgtaccgtgggactaccggatg
cgctccggtcgtacgctctgggaggagctggtcgatcactactaccggggtgtcgagacg
gtccggcgctggcagccgctctgggagtcgctccgggcgttcgtcgatccggagcgcttc
gagcagatcgccacgttgctgcgcattcaggaaaaagaagccgtctggtggcgcgatgcc
tgcgtgctgtatttccagacgttcagccggcgcccgattccggccggctacgagcagccc
gcccacacgctggactactacatcgaactgcaacgcaaacttcaacgattccccatgccg
gggcactgggtcggacgatag

DBGET integrated database retrieval system