KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1025Help
Entry
Rhom172_1025      CDS       T01606                                 

Definition
(GenBank) Beta-glucosidase
  KO
K05349  
beta-glucosidase [EC:3.2.1.21]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Cyanoamino acid metabolism
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rhom172_1025
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Rhom172_1025
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Rhom172_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1176910..1179288
Genome map
AA seq 792 aa AA seqDB search
MRLGIVFLLLLWSCAAWAQERPAYLDPTLPIEVRVEDLLGRMTLEEKVAQMLSMRQTKRL
IVDEQNRFDPSRAPEWFKLGIGRIERPSEYFQTAREAAAFTNAIQRWVRENTRLGIPVIF
HEEALHGLRAAEATSYPQAIALASTWNPALVERVYGRIAREVRARGVHQVLAPVVDVGRE
PRWGRIEETFGEDPYLVAEMGKAAVWGLQGRRVPPVGPGHVIATLKHMAGHGQPESGINV
APVFFGERHLREVFLYPFREAVEKAHALSVMASYNEIDGIPSHANAWMLRDVLRGEWGFR
GVIVSDWHGIPQLITRHHVAENLEEAARLALQATVDVELPDYEAYATLVDQVRRELIPEL
AVDEAVRRLLWAKFAVGLFDGEPYVDEAEASRVNASEEDRALALEAAREAIILLKNDGLL
PLEAGRLDRVAVIGPHAGEVLLGGYSGRPRYTVSILEGLRERLRGEAEVLYAEGVRITED
SVFTDEPQPHFGGTWAQQRNAAHRVVFTPPEANRSRIEEAVALARTSDVVVLVVGGNEQT
AREAYAPYHLGDRLSLRLPGQQEELVKAVLATGVPVVLVVIGGQPYVITELVDRVGAIVW
GWYLGQETGRAVAEVLLGDYNPAGRLPITIPRHEGQLPAYYSHKPSKELDYVDGPSRPLF
PFGYGLSYTRFAYRSVRLEPDRVGGCGVVRVLVELENVGDRAGDEVVQVYVRDRVSSVAR
PVKELKGFRRVHLGPGERKVVEIELGPEAFAFYGLEMERVVEAGWFDVLVGGNSEELISV
PLEITEGCNLGR
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgggaattgtcttcctgttgctgctctggagctgcgccgcatgggcgcaggag
cgaccggcgtatctggacccgacgcttcccatcgaagtgcgcgtcgaggacctgctcggc
cgcatgacgctcgaagaaaaagtcgcccagatgctgagtatgcgacagacgaagcggttg
atcgtcgacgagcagaatcgcttcgatccgagccgggcgccggaatggttcaaactgggc
attggccgcatcgagcggccgagcgagtatttccagacggcgcgcgaggcggccgccttc
accaacgccatccagcgctgggtcagagaaaacacacggctggggatcccggtgatcttt
cacgaagaggcgttgcacggtctgcgtgcggccgaagccacaagctatccgcaggcgatt
gcgctggcgagcacgtggaatccggcgctggtggagcgggtctacgggcggattgcgcgg
gaggtgcgggcgcgcggggtgcatcaggtgctggcgccggtggtggatgtgggtcgggag
ccgcgctggggtcggatcgaggagacctttggggaggatccgtacctggtggcggagatg
gggaaggcggccgtgtgggggttgcagggccgtcgggttccgccggtgggaccgggtcat
gtgattgcgacgctgaagcacatggcgggtcatggtcagccggagagtgggatcaacgtg
gcgccggtgtttttcggggagcgtcatttgcgggaggtgtttttgtatccgtttcgggag
gcggtggagaaggcgcatgcgctgagtgtgatggcttcgtacaatgagattgacgggata
ccgtcgcatgcgaacgcgtggatgttgcgggatgtgttgcggggcgagtggggcttccgc
ggcgtcatcgtctccgactggcatggcattcctcagctgattacccgtcatcatgtagcc
gaaaacctggaggaagccgcccgtctggcccttcaggctaccgtagatgtggaattgccc
gactacgaagcctacgcgacgctggtcgatcaggtgcgtcgggaactgattccggagttg
gcggttgacgaggcggttcgtcggttattatgggcgaagtttgcggtgggattgtttgac
ggggagccgtatgtggacgaggcggaggcttcgcgggtgaacgcgtcggaggaggatcgg
gcgctggcgttggaggcggcgcgcgaggcgatcattttgttgaagaacgacgggttgttg
ccgttggaggcgggtcgtttggatcgggtggcggtgattgggccgcatgcgggggaggtg
ttgctggggggatattcggggcgtccgcgttacacggtgagcatactggaggggttgcgt
gagcggttgcgtggggaggcggaggtgttgtatgcggagggggttcggatcacggaagac
tcggtcttcaccgacgaaccccagccgcacttcggcggcacatgggctcagcagcgcaat
gctgcacatcgcgttgtgttcacgccgcccgaggcgaaccggtcgcgcatcgaagaggcg
gtcgcgctggcccgcacgagcgatgtagtggtgctggtcgtgggtggtaatgagcagacc
gcccgtgaggcttatgcgccgtatcatcttggagatcgtttgtcgttgcggttgccgggt
cagcaggaggagttggtgaaggcggtgttggcgacgggtgtgccggtggtgctggtggtg
attggcgggcagccgtacgtgatcacggagttggtggaccgggtgggggcgatcgtgtgg
ggctggtatctgggtcaggagacgggtcgtgcggtggcggaggtgttgctgggggattac
aatccggcgggccgtttgccgatcacgataccgcgtcacgaggggcaacttccggcctat
tacagtcacaagccaagcaaggagttggactacgtggacggtccgagtcggccgcttttc
ccgttcgggtatggtttgtcgtacacgcgttttgcgtatcggagtgttcggttggagccg
gatcgggtggggggctgtggggtggttcgggtgctggtggagttggagaacgtgggggat
cgtgccggggatgaggtggtgcaggtgtatgttcgggatcgggtgagcagtgtggcgcga
ccggtgaaggagttgaagggatttcgtcgggtgcatctggggccgggggagcggaaggta
gtggagattgagctggggccggaggcgtttgcgttttacggcttggagatggagcgggtg
gtggaggcggggtggtttgatgtgctggtggggggtaattcggaagagttgatcagcgtg
cccctggaaatcaccgagggctgtaacctgggacgatag

DBGET integrated database retrieval system