KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1034Help
Entry
Rhom172_1034      CDS       T01606                                 

Definition
(GenBank) Site-specific DNA-methyltransferase (adenine-specific)
  KO
K03427  
type I restriction enzyme M protein [EC:2.1.1.72]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
Enzymes [BR:rmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     Rhom172_1034
Prokaryotic defense system [BR:rmg02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   Rhom172_1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1188283..1189866
Genome map
AA seq 527 aa AA seqDB search
MALDISTLETWLWDAACAIRGPVDAPKFKDYILPLVFLKRLSDVFEDEMDRLAEEYGSRE
VAQRIVEEEREQGIIARGGGSVRFYIPENARWKAIRTRGQAGLGQFLTDAVRAVARENPR
LQGVIDIVDFNATTAGQRIVADEYLARLVDVLSRHRLGLRDVEPDILGRAYEYLLRKFSE
GQGQSAGEFYTPREVAVLMARILEPQPGMTVYDPCCGSGGLLIKCHLRLLETHGEEQNGH
RRLPAHHAPLQLFGQEINPATFAMARMNAVIHDMEADIRLGDTMRHPAFRDETGRLMAFD
LVTANPMWNQNFPTDLYENDPYERFHLGIPPASSADWGWLQHMLASLKEGGRMAVVLDTG
AVSRGSGNQGASRERDIRKAFVERDLIEAVILLPENLFYNTSAPGIILVVNRQKRHPGEI
LLINASKLFAKGRPKNYLTDEHIETIARLYHEWQAEEGLSAIITNEEAARNDYNLSPSRY
VAQNGAEETLPLEEAMVLLREAEEERAEMEHRLQEVLGVLGLQGKGT
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcccttgatatctccacgctcgaaacctggctctgggatgccgcctgtgccattcgc
ggccccgtagatgccccgaagttcaaggattacatccttccgctggttttcctcaagcgc
ctttccgacgtgtttgaggatgagatggaccgtctggccgaggagtacggcagccgagag
gtagcacaacgtatcgttgaggaggaacgggagcaaggcatcatcgcccgtggtggcggc
tcggtgcgcttctacattcccgaaaacgcccgctggaaagccatccgtacccgtggccag
gccggcctgggccagttcctcaccgatgccgtgcgggccgtagcccgcgagaacccgcgt
ctgcagggcgttatcgacatcgtcgacttcaacgcgacaacggcagggcagcggatcgtg
gcagatgagtacctggcccgcctagtggacgtactctctcgccatcgcctgggcttgcgt
gatgtggaacccgacatcctgggccgcgcctacgagtacctgctgcgcaagttctccgag
ggccagggccagagcgcgggcgagttctacaccccgcgcgaggtggccgtgctcatggcc
cgcatcctggagccccaaccgggcatgaccgtctacgacccttgctgcggatctggcggg
ctgctcatcaagtgtcacctccgcctgctggagacccatggagaggaacaaaacggccac
cgccggttgcctgcccatcatgcgccgcttcaactctttggccaggaaatcaacccggcc
accttcgccatggcgcgcatgaatgcggtgatccacgacatggaggccgacattcgcctg
ggcgacaccatgcgccaccccgcctttcgcgatgagaccggccgcctcatggcctttgat
ttggtcaccgccaatcccatgtggaaccagaactttcctacggatctgtacgagaacgac
ccctacgaacgttttcacctgggcatcccgcccgcttccagcgcggattggggctggctg
caacacatgctggcctcgctgaaagaggggggccgtatggcggtggtgttggatacgggc
gcggtgagccggggcagcggcaaccagggtgcaagccgcgaacgcgacatccgtaaggct
ttcgtggagcgggacctgatcgaggcggtgatcttgttgccggagaaccttttctacaac
accagcgcgccgggcatcatcctcgtggtcaatcgccagaagcgccatcccggcgagatc
ctgctcatcaacgccagcaaactcttcgccaagggccggcccaagaattacctgaccgac
gagcacatcgagaccattgcccggctgtaccacgaatggcaggccgaggaagggctttcg
gccatcatcaccaacgaggaggcggcccgcaacgactataacctgagccccagccgctac
gtggcccaaaacggcgccgaggagaccctgccgctggaagaggccatggtgctgctgcgc
gaggcggaggaagagcgcgccgagatggagcaccgcctgcaagaagtgctgggagttttg
gggcttcaaggcaaggggacatag

DBGET integrated database retrieval system