KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1035Help
Entry
Rhom172_1035      CDS       T01606                                 

Definition
(GenBank) putative transcriptional regulator
  KO
K03655  
ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rhom172_1035
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Rhom172_1035
DNA repair and recombination proteins [BR:rmg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Rhom172_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1189870..1191216
Genome map
AA seq 448 aa AA seqDB search
MEKLEATEGQTLEFKRQWTDRALEDLAAFANTEGGRLLLGVRDDGEVVGTRADDRELQRI
ANLIAAHLGITPSVRVIEMQGLPVVEIRVDPAPGLVPYKGRYLRRVGSTNRDFSPEELAR
HILTRSGRSWDGLPSDWTLKEVDPEALKAFARLARERLPHLDPSDPEGTLRNLNLVEGER
LKNAGVLLFGKRPQRLFPQAQVRVGIFRGDEILDSHDFTGTLWEQLDGVMARFRQVLKVR
FAIRVEEPSLAGLQREETWEYPLEALREAVVNALIHRDYTYPADIQIRLEEDRLEVWSPG
ELPSPLTPEQLYQPHSSVLRNPLLAQAFYFAGVIERWGTGTTRIVRLCREQGLPEPEFAN
WQGGFRVTFLKDPYTPERLRKLGLNERQIRAVLYVKEHGEISNRDYRSLTGVSDETARQD
LLALVKLNILRVEGKGRATRYVLGSFGD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcttgaggctacggaaggccaaaccctggagttcaaaaggcaatggaccgat
cgggctctggaggatctggcggccttcgccaacacggaaggcggtaggctcctcctcggc
gtccgagacgatggggaagttgtgggcacgcgagcggatgaccgagaactccagcgcatc
gccaacctcatcgccgcccatctgggcatcacgccgtcggttcgcgtgattgagatgcag
ggcctgccggtggtggaaattcgggtagacccggccccggggttggtgccctacaagggg
cggtatctccgccgtgtgggcagcacaaaccgcgatttctcccccgaggaactggcccgc
catatcctcacgcgttccgggagaagttgggatgggctccccagcgattggacgctgaag
gaggtggatccggaagccctgaaggcctttgcccgcctggctcgagagaggcttccccat
ctcgatccctccgatcccgaagggacgctgcgcaacctcaacctcgtagagggggagcgg
ctgaagaacgcaggggtgctgctctttggcaagcggccccagcgcctctttccccaggcg
caggtgcgcgtcggcatcttccggggagatgagatcctggatagccacgatttcacgggc
accttgtgggagcagttagacggggtgatggcgcgctttcgccaggtgctcaaggtgcgt
ttcgccatccgggtggaagagccgtctttagcggggctacagcgtgaagagacatgggaa
tatccgctggaggccctgcgggaggcggtggtgaacgccctcatccaccgggattacacc
tatccggcggacatccagatccgcttggaggaagatcgcttggaggtttggagtccgggg
gagttgccgtcgccgcttacgcctgagcagctctatcaaccccactcgtcggtgcttcgt
aatccccttctcgcccaggccttctactttgccggcgtcatcgaacgctggggcacgggc
accacgcgcatcgtccgcctctgccgggagcaagggcttccggagcccgagtttgcgaac
tggcagggtggctttcgggtgaccttcctgaaggacccttacaccccggagcggctacgc
aagttgggcctgaacgagcggcagatcagggcagtgctgtatgtgaaggagcatggggag
atctcgaatcgtgactacagaagtctgacaggtgtgtcggacgaaacggcccgccaagac
ctcctggcgctggtcaaactgaacatattgcgggttgaaggcaaggggagggcaacgagg
tatgtgctggggagttttggcgattaa

DBGET integrated database retrieval system