KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1037Help
Entry
Rhom172_1037      CDS       T01606                                 

Definition
(GenBank) hypothetical protein
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1192677..1193348
Genome map
AA seq 223 aa AA seqDB search
MTRYDPQRHRRSIRLKGYDYTQPGAYFITICTHGRAPLFGDVVDGEMRLNDMGEIVRAEW
FKTAQLRPYVVLHEDEFVVMPNHIHGIIWIVDDVGATRRVAPTKTNPPAGPAPGSIGAIV
GAFKSAVTQRINQRCGTPGTSVWQRDYYEHIIRTERALNAIRRYIAENPLRWHLDRYNPY
ATGTDPQTRDLWRLLQTDARARPHGTGDPLDRPKSRDDQEDRP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacccgatacgacccccaacgccaccgccgttccatccggttgaagggatacgattac
acccaaccgggcgcgtatttcatcaccatttgcacccacgggcgcgcccctctgtttggc
gacgtggtggacggggaaatgcggttgaacgacatgggggaaatcgtgcgcgcggaatgg
ttcaaaacggcccaattgcggccgtacgtggtgttgcatgaagacgaattcgtggtcatg
cccaaccacatccacggcatcatttggatcgtggacgatgtaggggcgacgcgccgcgtc
gcccctaccaaaaccaacccacccgccggccccgcgccgggttctattggcgccattgtg
ggtgcattcaaatccgcggtcacgcagcgcatcaaccaacggtgcggcacccccggcaca
tccgtctggcaacgcgattactacgaacacatcatccgcaccgagcgcgccctgaacgcc
atccggcgctacatcgccgaaaatcccctgcgctggcacctggaccgctacaacccctac
gctaccggcaccgacccgcagacccgcgacctgtggcgcctgttgcaaaccgacgcgcgg
gcccgcccccacggtacgggcgacccattggatcgccccaaatcccgggatgaccaggag
gaccggccatga

DBGET integrated database retrieval system