KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1038Help
Entry
Rhom172_1038      CDS       T01606                                 

Definition
(GenBank) type I site-specific deoxyribonuclease, HsdR family
  KO
K01153  
type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     Rhom172_1038
Prokaryotic defense system [BR:rmg02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   Rhom172_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1193345..1196269
Genome map
AA seq 974 aa AA seqDB search
MTLASERRIVQNPFIRYAEEAGWQYLSPEEALRLRGGEDSPILHTVFIEQLQRLNPGIVD
SVTKAEEVFNRLIRVRPNIEGNLEAWEYLKGLKTVFVEAERRERNLRLLDTENIEANRFH
VTDEFRFVSGHVAIRADVVLFVNGIPVIVVETKAATRPEGIAEAFDQIRRYHQEAPELMA
QAQIFALTHLGRFFYGATWSLSRKTLFNWREDLERQRAVSQQPADFETLVKSFVAPRRVL
RVLTEYILFTRRDGELSKVVLRPHQMRATEKVIARARDPQRRRGLVWHTQGSGKTYTMIT
VAKLLLEDPRFQNPTVLMIVDRNELQQQLFQNLESVGFGRVHVARSKRHLRELLRQDTRG
LIVSMIHKFDKADAHLNTRANIFVLIDEAHRSTGGDLGNYLMGALPNATFIGFTGTPIDK
SAHGKGTFKTFGGDDPGGYLDKYAIRESIEDGTTVPLHYQMAPNDLIVDRSAMEAEFWKA
AALEGVTDVEELNRVLDRAVTLKNLLKNRQRVERIASFVAKHYRTYVEPMGYKAFLVAVD
REACGLYKEALDHHLPPEYSQVVISRGHNDPPELKRWHLSDEEEAAVRKAFRKPDQPPYI
LIVTEKLLTGYDAPILYAMYLDKPMRDHVLLQAIARVNRPYEDDEGRRKTNGLIVDFVGI
FDNLERALAFDSQDVEGVVEGLDVLKERFEILMQQGREAYLPLRAGKSEDKAADAVLEHF
RDREAREAFYAYFRELQEVYEILSPDPFLRPFLEDYRALVAMYRLLRSAYEPHVSVDKSF
LRKTAEIVQQHTTTQAVHEPQATYEIGAGALLALVAQDKPDAVKVFNLLRALHRLVEAQG
KEQPHLIPIGERAEAIRQAYEARQMNSQQALEALNDLVRRLQEAEEEWRESDLTPEAFAV
AWWLRVQKEMDAPQAHRLAAHIEPAFRAFPHWATSQHQERELRKQLYKILVEAGVKEVVA
WTNEVLTLLRGASS
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgccagcgaacgccgcatcgtccaaaaccccttcattcgctacgccgaggag
gccggctggcagtatctatctccggaggaagccctgcggctccgcggcggagaggatagc
cccatcctgcacaccgtttttatcgagcaactgcagcgcttaaaccccggaattgtggat
tcggtgaccaaggccgaggaggtcttcaaccgtctcatccgggtacggcccaacatcgaa
ggcaacctggaagcctgggaatacctcaaggggctgaaaaccgtcttcgtcgaagccgag
cgccgcgagcgcaacctgcgcctgctcgatacggagaacatagaggccaatcgcttccat
gtcaccgacgagtttcgcttcgtcagcggccacgtcgccatccgcgcggatgtggtgctc
ttcgtcaacgggatccccgtgatcgtggtggaaaccaaggcggccacccgccccgaaggc
attgccgaagccttcgaccagatccgccgttaccaccaggaagcgcccgaactcatggcc
caggcgcagatcttcgccctcacccacctgggcaggtttttctacggtgccacctggagc
ctatcgcgcaaaactctcttcaactggcgggaagatcttgagagacagcgcgccgtgtcc
caacaacctgccgatttcgaaaccctggtcaaatccttcgtcgccccacggcgggtgctg
cgcgtgctcaccgaatacatccttttcacccgccgtgatggcgagttgagcaaggtggtc
ctgcgcccccaccagatgcgggccaccgaaaaggtgattgcccgcgctcgggacccgcag
aggcgccgtggcctggtctggcacacccagggttcgggcaagacttacaccatgattacg
gtggccaaactactgctggaggacccgcgcttccagaaccccacggtcctcatgatcgtg
gaccgcaacgaactccagcagcaactcttccaaaacctggagtccgtcggctttggccgg
gtgcatgtggcccggagcaaacgtcatctgcgcgaacttttgcgccaggacacccgcggc
ctgatcgtgtccatgatccacaaattcgacaaggccgacgcgcacctcaacacccgcgcc
aacatcttcgtgctcatcgacgaagcccaccgctccaccggcggcgacctgggcaactac
ctgatgggcgccctgcccaacgctaccttcatcggcttcaccggcacgcccatcgacaaa
agcgcccacggcaagggcaccttcaagaccttcggcggggacgaccccggcggctatcta
gacaaatacgccattcgcgagtccatcgaggacggcaccaccgtgcccctacactaccag
atggcccccaacgacctgatcgtggaccggagcgccatggaagcggagttttggaaggcc
gccgccctggagggagtgaccgatgtggaagaactcaaccgtgtcctggaccgggccgtg
accctcaagaacctgctcaagaaccgccagcgcgtggagcgcattgcctcctttgtggcc
aagcactaccgcacctatgtggagcccatgggctacaaagcctttctcgtcgccgtggac
cgcgaggcctgcggcctgtacaaggaagccctggatcaccacctgccgccggaatacagc
caggtggtcatcagccgagggcataacgacccgcccgaactcaagcgctggcatctgagc
gatgaggaagaggcagccgtgcgcaaagccttccgcaagcccgatcagcctccctacatc
ctcatcgtcaccgaaaagctgctcaccggctacgacgcgcccatcctctacgccatgtac
ctcgacaagcccatgcgcgaccatgtgctcctgcaagccattgcgcgggtcaaccgtccc
tatgaggacgacgagggccggcgcaagaccaacggcctgatcgtggacttcgtgggcatc
ttcgacaacctggagcgggccctggccttcgattcccaggatgtggaaggggtggtggaa
gggctggatgtgcttaaggagcgctttgagatcttgatgcaacaagggcgggaggcgtat
ctacccctgcgtgcaggcaaaagcgaagacaaggcggccgatgccgtgctggagcacttc
cgcgaccgggaggcgcgcgaggctttctacgcctactttcgcgaactgcaggaggtgtac
gaaatcctttcgcccgatcccttcctgcgccctttcctggaagactatcgcgccctggtg
gcgatgtaccgtctgctgcgcagcgcctatgagccgcacgtgtcggtagacaaatccttc
ctgcgcaagacggccgagatcgtccagcaacacaccaccacgcaggccgtccacgagccc
caggccacctacgagatcggcgccggtgcgctgctggcgctcgtcgctcaggacaaaccc
gacgcggtcaaggttttcaacctgctccgggcactgcatcgcctggtggaagcccaaggg
aaggaacagccccacctgatccccatcggcgagcgggccgaagccatccgtcaggcttac
gaagcgcggcagatgaacagtcagcaggccttggaagccctgaacgacctggtgcgccgc
ctgcaagaagccgaggaagagtggcgcgagagcgaccttacaccggaagcctttgccgtg
gcctggtggttgcgggtgcaaaaggagatggacgcaccgcaagcccaccgtctggctgcc
cacatcgaaccggccttccgggccttcccccactgggccaccagccagcaccaggagcgc
gagctgcgcaagcaactctacaaaatcctggtcgaggcgggagtcaaggaagtggtcgcc
tggaccaacgaagtgttgaccctgttacggggggcatcctcatga

DBGET integrated database retrieval system