KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1049Help
Entry
Rhom172_1049      CDS       T01606                                 

Definition
(GenBank) ribosomal protein L11
  KO
K02867  
large subunit ribosomal protein L11
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Rhom172_1049
Ribosome [BR:rmg03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Rhom172_1049
  Bacteria
    Rhom172_1049
  Archaea
    Rhom172_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1205336..1205776
Genome map
AA seq 146 aa AA seqDB search
MAKKVEKIIKLQIRGGQATPAPPIGPALGQAGVNIMEFCKQFNAATQDRMGVVLPVVITV
YSDKSFTFVVKSPPAAELLKKAAGIEKGASDPLRQKVGKVTWEDCLEIARQKMADLNAYD
LEKAASMIAGTARSMGIVVEGKPEHL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaggtcgaaaagattatcaaactccagattcggggtggccaggcgacgccc
gccccgccgatcggccccgcgctcggtcaggccggggtcaacatcatggagttctgtaag
cagttcaacgcggccacgcaggaccgcatgggggtggtcctgccggtcgtgatcacggtt
tactcggacaaatccttcacctttgtcgtcaagagtcccccggcggccgagctgctcaag
aaggcggccggtatcgagaaaggcgccagcgatccgctgcgccagaaggtggggaaagtg
acgtgggaggattgcctggaaatcgccaggcagaagatggccgacctgaacgcctacgat
ctggagaaggcggcgtcgatgatcgccgggacggcgcgttcgatggggatcgtggtggaa
ggcaagcccgagcatctctga

DBGET integrated database retrieval system