KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1051Help
Entry
Rhom172_1051      CDS       T01606                                 

Definition
(GenBank) 50S ribosomal protein L10
  KO
K02864  
large subunit ribosomal protein L10
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Rhom172_1051
Ribosome [BR:rmg03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Rhom172_1051
  Bacteria
    Rhom172_1051
  Archaea
    Rhom172_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1206583..1207113
Genome map
AA seq 176 aa AA seqDB search
MPLTRAQKAAILEEISAKLESAPVVYVTDYMGLNVAQITDLRRRFREAGVEFKVVKNTLL
RIAMEQRGGYDELLPVLNGPTAIAVGDEPAAPARVIKKFIEEQGVELPRLKAAYIDGAVY
GADALDTLAALKSKDELIADIVGLLLAPARNVVGALQGPGQTLAACLQAIAEKEAA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgaccagagcccagaaagcggccatcctggaggaaatcagcgccaagctggag
tcggcgccggtcgtctacgtgacggactacatggggctgaacgtggcccagatcaccgac
ctgcggcgtcgattccgggaggccggcgtggaattcaaagtcgtcaaaaacacgctgctc
cgaatcgccatggagcagcggggcggctacgatgagctgctgccggtgctgaacggcccc
acggcgatcgccgtgggcgacgagccggccgcaccggcccgcgtgatcaagaagttcatc
gaggagcagggcgtcgagctgccccggctgaaggccgcctacatcgatggggctgtctac
ggggccgacgcgctcgacacgctggccgcgctgaagtcgaaggacgaactgatcgccgat
atcgtcggcctgctgctggcacccgcccgcaacgtggtgggcgcgctgcagggaccgggc
cagacgctggccgcctgcctgcaggccatcgccgaaaaagaagccgcataa

DBGET integrated database retrieval system