KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1055Help
Entry
Rhom172_1055      CDS       T01606                                 

Definition
(GenBank) peptidase M14 carboxypeptidase A
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1216172..1218760
Genome map
AA seq 862 aa AA seqDB search
MTVKRLFKRLLAGMLLGLGVCCPKIVQGQPAFPLPLPLPEAMSYDPAVPKPEEVIGHVVG
TRHTAPHQIVAYFQAVATASDRVLVEEHGRTYEGRPLIHAIVSAPENLMRLEEIRRANLR
LSDDPASVSDAELARMPVVAYLGYSIHGNEASGSEASLLTLYYLAAARGPEIDSLLAQAV
LIVDPMFNPDGRDRFVDWANRNRGRVPVADPQDREHLEPWPGGRTNHYWFDLNRDWLTGQ
HPESQGRLRLFHHWRPQLLTDHHEMGSESTFFFMPGVPSRTHPLTPARNQELTAAIARYH
AEALNRIGSLYYSEEGYDDFYYGKGSTYPDANGAVGILFEQASSRALLRETRDGVLSYAF
TIRNQFTTSLSTLRALRALRLELLRYQRDFYREAEEIARRLPVKAYLIALEPGRTRAQML
AEVLRRHRIRVYTLARDVTVDGKTFRAGQAYVVPTQQPQVRLLQALMERRTTFEDSLFYD
VSAWTLPLAYDVVWAEWQRDPSELLGTPVDSVRLDGGELAGGRSDYAYLMTWDRFYAPAA
LYRLLQAGVRARVLTEAVTLPVAGSRRTFPPGTVLIPVVQRDGKGPASDSLQALLRELVD
TYHVRFFAVQTGLTEQGPDLGTRDYGQVLEQPRVALLTGEGTRAYNAGEVWHLLSERMQM
PVSLLDVDNVAWADLSRYNRLVLAGGSYNALPAEKIKNWVRQGGVLIALTNAVEWVVEQG
MVNLKARPFNLDSLLRPYPYGQLERARGAQVIGGAILEARLDTTHPLAFGLGATLPVFRT
EETFYDPSETPGANVAVYTEQPLRSGYLSATRRKQASGAAAVVAQRYGRGRIILIMDNPN
FRAFWVGSSRLFLNAICFGDAF
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagcgtctgttcaagcgtttgcttgctggtatgctgctggggctgggcgta
tgctgcccgaagatcgtacagggccagcccgcctttccgctgcccctgccgttgcctgaa
gccatgtcctacgatccggctgttccgaagccggaggaggtaatcgggcacgtggtgggt
acgcgtcacaccgctccgcatcagatcgtggcctactttcaggccgtggcgacagccagc
gatcgggtgttggtcgaggagcacggccgcacctacgagggacggccgctgatccacgca
atcgtttcggcgcccgaaaacctgatgcgtctggaggagatccgccgggccaacctgcgg
ctttcggacgatccggcgtccgtctccgacgccgaactggcccgtatgccggtcgtcgcc
tacctgggctacagcatccatggcaacgaagccagcggctccgaagcgtcgctgcttacg
ctttactacctggcggcggctcgcggaccggagatcgattcgctgctggcgcaggctgtg
ctcatcgtcgatcccatgttcaatccggacggccgggatcggtttgtggactgggccaac
cgcaaccggggccgcgtgcccgtggccgatccgcaggaccgcgagcacctcgagccctgg
cccggcggccgcaccaaccactactggttcgacctgaaccgtgactggctcaccggccag
catccggagtcgcagggacgcctccggctcttccatcactggcggccgcagttgctgacg
gatcaccacgagatggggagcgagtccaccttcttcttcatgccgggcgtgcccagccgc
acgcacccgcttacgccggcgcgcaaccaggagctgacggccgccatcgcccgctatcat
gccgaagcgctcaaccggatcggctcgctttactactcggaggaaggctacgacgacttc
tactacggcaagggttcgacctacccggacgccaacggcgccgtcggtattctcttcgaa
caggcttcgtcgcgcgcgctgctccgggaaacgcgcgacggggtgctttcctatgccttc
acgattcgcaatcagtttaccacctcgctttcgacgctgcgggcgctgcgtgcgttgcgg
ctggagctgttgcgctaccagcgcgacttctaccgggaggccgaagaaattgcccgtcgc
cttccggtcaaagcctacctgatcgcgctggagccgggccgcacgcgggcccagatgctg
gccgaggtgctccggcggcaccgcatccgggtgtacacgctggcccgcgacgtgacggtc
gacgggaagacgttccgggccggacaggcctacgtggtgcccacgcagcagccacaggtc
cgtctgttgcaggcgctgatggaacgccgtaccacattcgaagactcacttttctacgac
gtgtcggcctggacgctgccgctggcctacgatgtggtctgggccgaatggcagcgcgat
ccgtcggagctgctggggacgcctgtcgattcggtgcggctggacggaggcgagctggcg
ggcggccgctccgattatgcctatctgatgacctgggatcggttctacgcgccggcggcc
ctctaccgcctcctgcaggccggcgtgcgggcgcgggtgctcaccgaagcggtcacgctg
cccgtagcaggcagtcgccgcacgtttccgcccggcaccgtgctgatcccggtcgtgcaa
cgcgacggcaaggggccggcgtccgactcgcttcaggcgctgctgcgtgagctggtcgac
acctaccacgtgcgcttctttgcagtccagaccggcctgaccgagcaggggcccgacctg
ggcacgcgcgactacgggcaggtgctcgagcagccccgcgtggcactgctgaccggcgag
ggcacgcgcgcctacaatgcgggcgaggtctggcacctgctctccgagcgcatgcagatg
cccgtctcgttgctggacgtggacaacgtagcctgggccgatctgagccgctacaaccgg
ctggtgctggccggcggctcgtacaacgcactcccggctgaaaaaatcaaaaactgggtg
cggcagggtggcgtgctgatcgccctgaccaatgccgtcgagtgggtcgttgagcagggg
atggtaaaccttaaagcccggcccttcaacctggattcgctgctgcggccctacccgtac
ggccagctggagcgtgctcgcggtgcgcaggtgatcggcggggccatcctggaagcccgg
ctcgacaccacgcatccgctggccttcgggctgggggccacgctgccggtcttccgcacc
gaagaaaccttttacgatccctccgagacgccgggcgccaacgtggccgtctataccgag
cagccgctgcgcagcgggtatctctcagccacccgccggaaacaggcatccggcgccgcc
gccgtcgtggcccagcgctacggacgcggccgcatcatcctgatcatggacaacccgaac
ttccgggccttctgggtgggatcgagccggctgtttctgaacgcgatctgcttcggcgac
gcgttctga

DBGET integrated database retrieval system