KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1060Help
Entry
Rhom172_1060      CDS       T01606                                 

Definition
(GenBank) peptidase S45 penicillin amidase
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1222601..1224475)
Genome map
AA seq 624 aa AA seqDB search
MKRPLLLIATLVTGLLLLLGGYRYLIREVETPPAHRVVSGLQAAVAIEELPGHAVAIRAE
NLNDALAALGYVHGLRHGWPLLLWRQAALGRQAEWFGAAPVPLDSLIHALLVPEQARAAY
EHLPQHARALLDSYTRGLQTALQERAVRLRDELMLLQISVAPWLPWHSLAVERLLALLML
PDTLDAALPGLSALRAWLHLYGFRHSLAWVRSTPEGTRQLFMRYVYGDLALPFLQEVLLT
LPDDTLRLVTVPGTLSFPAGRTTRRAWYLLPHVRPPALEERPRRTLALKSTYARFRLPDG
DERLLRREHGGDALVLAEVAPDTVHLLRWAGLAPVSDLPAWLALLADSTATFRLLAGDGL
LLTDEGYRLLGQPPVVEPLGAGVLIGQTDWHRWIARRLRTLPPSTTPPDDAVSTWAQEQL
AALLPALDTLAPPDSLTREAYTLLRNWNAAYDAASIGATIFDHWLFRYRQRGGTSALREL
PDSLRLIHARLLAATFREAVDTLAHRLGPDLNLWRWERAHPRRLAFPVWSHLPDLPAATR
YAPLVLPGEGHPSTIRWGYSPLLQERPTPAFWEGWTIAPGTSFYVRRLWPEVDRFLARYR
FSARVTVTALRETAPLRTLRLTPH
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtccgctgctcctgatcgccaccctcgtcacgggcctgctgcttctgctgggc
gggtatcggtatctcatccgtgaagtcgagacgcctccggcgcaccgcgtcgtctccggc
ctgcaggccgccgtcgcgatcgaagaacttcccggccacgctgtggccatccgggcagaa
aacctcaacgacgcgctggcggcgctgggctacgtgcacggactccgacatggctggccg
ctgctgctctggcgacaggcggcactggggcgtcaggccgaatggttcggagccgcgccc
gtcccgctcgacagcctgatccacgcgctgctcgtgcccgagcaggcccgggccgcctac
gagcacctgccgcagcatgcgcgggcgctgctggacagctacacccggggcctgcagact
gccctgcaggaacgcgccgttcgcctccgcgacgaactgatgctgctacagatctccgta
gcaccctggctcccctggcacagcctggccgtcgagcgactgctggccctgctgatgctg
ccggacacgctcgacgcagcgcttcccgggctgtcggccctgcgcgcctggctccatctg
tacgggtttcggcacagcctggcctgggtgcgttcgacgcccgaagggacccggcagctc
ttcatgcgctacgtctacggcgacctggcgctgcccttcttgcaggaagtgctgctcacg
ctgcccgacgacacgctccgcctggtgaccgttcccggcacgctgagcttcccggccgga
cgaaccacccgccgggcttggtacctgctgccccacgtccgcccccccgcgctggaggag
cgcccccgccgcacgcttgcgctgaaatccacctatgcacgttttcggctacccgatggc
gacgagcgcctgctccgtcgcgagcacggcggcgacgccctggtgctggccgaagtcgcc
ccggacaccgtgcatctgctccgatgggccggactggcaccggtcagcgacctgccggcc
tggctggccctgctggccgacagcacggcgacgttccgactgctcgcaggcgacgggctg
ctgctgactgacgagggttaccggctgctggggcaaccgccggtcgtcgaaccgctgggc
gcgggcgtgttgatcggccagaccgactggcaccggtggatcgcccggcgccttcgcacg
ctccctccgtccacgaccccgccggacgatgccgtcagtacctgggcgcaggagcaactg
gccgcgttgctgccggcgctcgatacgctggcgcctcccgactcgctgacccgcgaggcc
tacacgctgctgcgcaactggaacgccgcctacgacgccgccagcatcggggccacgatt
ttcgatcactggctctttcgataccggcagcgtggcggcacgtcggccctccgggagctt
ccggattcgctgcgcctcatccacgcgcggctgttagcggccacgttccgagaagccgtc
gatacgctggcgcatcgtctgggtccggatctcaacctgtggcgctgggagcgcgcgcat
ccacgccggctggccttcccggtctggtctcacctgccagatctcccggctgccacgcgg
tatgcaccgctggtgctccccggcgaaggacatccgtccaccatccggtggggctattcg
ccgctgcttcaggagcgtccgactccggccttctgggagggctggaccattgcgcccggc
acctcgttctacgtacgccgcctctggccggaggtcgatcgttttctggcacgctatcga
ttttccgcccgcgttaccgtcacggcccttcgggaaaccgcgccccttcgcacgcttcgg
ctgacgcctcactga

DBGET integrated database retrieval system