KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1061Help
Entry
Rhom172_1061      CDS       T01606                                 

Definition
(GenBank) PHP domain protein
  KO
K02347  
DNA polymerase (family X)
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
DNA repair and recombination proteins [BR:rmg03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA polymerase
    Rhom172_1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1224472..1226154)
Genome map
AA seq 560 aa AA seqDB search
MENRDVARLLRETARLLELRGENPFRVRAYEQAAEAIEQLDEPVAERVRKGTLTEVPGIG
RGLAAQIQELVERGTSEVLERLRQELPPGLPELLTLKGLGPQRVRQLWQTLGIASLDDLE
AALRDGRLSQLKGFGPRLREQLLHALSLRRRYRTLRLLAQVLPEAEALRERLQQQPGVIR
VELAGAVRRLMEVVDRVELVVAGSAEAVQQILPQLRQQPGPHGETLLEGALPDGFPVRVA
LTTPDAFGTVLWWHTGSEAHCRAFVRTYGAPEPCPEEATIYERAGLPFIPAELREDRGEL
EAAAHHALPALIAQKDLRGVLHNHSTYSDGHNSLREMAEAACNRGFRYFGTGDHSQSLTI
ARGLSIAEVRRQQEEIQTLNEQFAARGFRILSGTECDILPDGSLDYPDDVLASFDYVVAS
VHTRLNMDEKTATERILRALRNPHVMILGHPTGRLLLRREGYPLDWPRIIDACATYRVAL
ELNANPYRLDIDWRRVREATAAGVPIVINPDAHAIDELDHVRWGVAAARKGWLTPEACLN
ARDLDELLAWLHQRRQASQP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccgagacgttgcccgcctgctgcgtgagacggcccgcctgctggagcttcgc
ggcgaaaatccgtttcgcgtgcgggcctacgagcaggccgccgaagccatcgagcaactg
gacgaacccgtcgccgagcgggtgcgaaagggcacgctcaccgaggtgcccggcatcggc
cggggtctggccgcccagattcaggaactggtcgaacggggcacctcggaggtgctggag
cgcctccggcaagaactgccgccggggcttccggagttgctcacgctgaaaggcctgggc
ccccagcgcgtgcgccagctctggcagacgctgggcatcgcctcgctggacgacctggag
gctgcacttcgcgacgggcgcctgagccagctcaaaggctttggtccacgcctgcgcgaa
caactgctccatgcgctgtcgctgcgccgacgctaccgtacgcttcgcctgctggcgcag
gtactgcccgaagccgaggcgctccgagaacggcttcagcagcagcccggcgtgatccgc
gtcgagctggccggggccgtccggcgcctgatggaggtggtggatcgggtggaactggtc
gtggccggatcggcggaagccgtgcagcagatacttccgcaactccggcaacaacccggc
ccccacggcgaaacgctgctcgaaggcgccctgccggacggttttcccgtccgggtggcg
ctgaccacgccggacgccttcggcaccgtgctctggtggcacaccggctcggaagcccac
tgccgggcgttcgtccgcacctacggcgccccggagccctgtccggaggaagccaccatc
tacgaacgggcgggtctgcccttcattccagccgagctgcgcgaagaccgcggcgaactg
gaagcagcggcccaccacgcgctgcccgcgttgatcgcacagaaagacctccggggcgtg
ctgcacaaccattccacctacagcgacggtcacaattcccttcgcgaaatggccgaggcc
gcctgcaaccggggctttcgctacttcggaacgggcgatcacagccagtcgctcaccatc
gcccgtgggctttcgatcgccgaagtgcgccgccagcaggaagagatccagaccctgaac
gagcagttcgccgcacggggctttcggatcctgagcggcaccgagtgcgacatcctgccc
gacggatcgctggactaccccgacgacgtgctggccagcttcgattatgtggtggccagc
gtgcatacccggctgaacatggacgaaaaaacggccaccgagcgcatcctgcgcgccctg
cgcaatccgcatgttatgatactgggccacccgaccggccgcctgctgctgcgacgtgag
ggctatccactggactggcctcgaatcatcgacgcctgcgccacctatcgcgtcgccctc
gaactgaacgccaacccgtatcggctcgacatcgactggcggcgcgttcgcgaagcgacg
gccgccggcgtgcccatcgtgatcaacccggacgcccatgccatcgacgaactggaccac
gtgcgctggggcgtggccgccgcccgcaaaggctggctcacgcctgaggcctgcctgaat
gcccgggatctggacgaactgctcgcctggctccaccagcgtcgccaagccagccagcca
tga

DBGET integrated database retrieval system