KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1063Help
Entry
Rhom172_1063      CDS       T01606                                 

Definition
(GenBank) MotA/TolQ/ExbB proton channel
  KO
K03561  
biopolymer transport protein ExbB
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
Transporters [BR:rmg02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rhom172_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1228073..1228798
Genome map
AA seq 241 aa AA seqDB search
MELLSLLLMLPQAAAGEEGFINVLVQRFNEGGEFMWPVLISLIIGLAIAFERIITLNLAD
INTRKFILQVKKALEEGGIQAAEEICAKTRGPVASVFQAGLLRADEGIEAVEKAIVSYGS
IEMSFLERGLVWLSLFISLAPMFGFLGTVVGMVQAFDAIEQAGDISPSLVAGGIKVALLT
TVFGLITAIILQFFYNYAVSKIDRIVVDMEEASIELIDSLVLMQAGRPLTAAEKAEASKQ
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaactgctgagcctgctgctgatgctgcctcaggctgccgccggagaagaaggcttc
attaacgtcctggtccagcgcttcaacgaaggcggcgaattcatgtggccggtcttgatt
tcgctcattatcggtctggccattgccttcgagcggatcattacgctgaacctggccgac
atcaacacgcgcaagttcattcttcaggtgaagaaagcgctggaggagggcggtattcag
gcggccgaagagatctgcgccaagacgcgcggaccggtggcttcggtcttccaggccggg
ctgctccgggccgacgagggtatcgaagccgtcgagaaggcgatcgtgtcctatggttcg
atcgagatgagcttcctggaacgcgggctggtgtggctgtcgctgttcatctcgctggct
ccgatgttcggcttcctcggtacggtcgtcggcatggtgcaggccttcgacgccatcgaa
caggccggcgacatttcgcccagcctggtggccggtggtatcaaggtggccctgcttacc
acggtcttcggtctgatcacggccatcatcctgcagttcttctataactacgcggtttcg
aagatcgaccggattgtggtggacatggaggaggcctcgatcgagctgatcgactcgctg
gtgctgatgcaggccggacggccgctgaccgcagccgagaaggcggaagcgtccaagcag
tcgtaa

DBGET integrated database retrieval system