KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1064Help
Entry
Rhom172_1064      CDS       T01606                                 

Definition
(GenBank) conserved hypothetical protein, membrane
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1228841..1229116
Genome map
AA seq 91 aa AA seqDB search
MEGIVPLAIWAALILLGLGLVAQVIFGLRNLTYGKISPISMLIVVLPVLLMVVLGFTVGS
WAQAGVITVLVMFVLTAIALLLSGLRNMFSF
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcattgttcctctggccatctgggcggctctgatcctgctggggctggggctg
gtagcccaggtgatttttggcctgcgtaacctgacctacgggaagatcagcccgatttcg
atgctgatcgtcgtgttgcccgtgctgctgatggtcgtgctgggcttcacggtagggagc
tgggcgcaggccggcgtgatcaccgtactggtgatgtttgtgttgaccgccattgccctg
ctgctttcggggctgcggaacatgttcagcttttaa

DBGET integrated database retrieval system