KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1066Help
Entry
Rhom172_1066      CDS       T01606                                 

Definition
(GenBank) Biopolymer transport protein ExbD/TolR
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1229708..1230166
Genome map
AA seq 152 aa AA seqDB search
MASQHFKKKAETKQAIPTASLPDIIFMLLIFFMVSTVLRETTIQVRTLLPRAEALTKIDQ
KRLLSYVYIGPHKKPDGTLGETRVQIDDALIDDLTLIRTIMYNKLVEQPKLIVSLRIDQD
ARMKLVYDVQQELREAGTLRINYSARPEAPAS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcagcactttaaaaagaaggcggaaaccaagcaggcgattcccaccgcctcg
ctcccggatatcattttcatgctgctgatcttcttcatggtcagcacggtgctccgggaa
accaccatacaggtccggacgctcttgccccgggcggaggcgctgaccaagatcgaccag
aaacgcctgctctcttacgtctatatcggtccgcataaaaaaccggacgggacgctggga
gaaacgcgcgtccagatcgatgatgcgttgatcgacgaccttacgttgattcgcacgatc
atgtacaacaagctggtggagcagcccaagttgatcgtgtcgctgcgcatcgatcaggac
gccaggatgaagctggtctacgacgtgcagcaggaacttcgggaggccggaacgcttcgc
atcaactactcggcgcggcctgaggcgcctgcgtcgtag

DBGET integrated database retrieval system