KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1092Help
Entry
Rhom172_1092      CDS       T01606                                 

Definition
(RefSeq) succinyl-CoA ligase (ADP-forming) subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rhom172_1092
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rhom172_1092
   00640 Propanoate metabolism
    Rhom172_1092
   00660 C5-Branched dibasic acid metabolism
    Rhom172_1092
Enzymes [BR:rmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rhom172_1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1265341..1266528
Genome map
AA seq 395 aa AA seqDB search
MKLHEYQAKDILQRYGVATQPGYVARTVEEAVEAARRLQQEQGYELFVVKAQIHAGGRGK
GGGVKLAKGIEEVREKAGAILGMNLVTPQTGPEGQKVRAVLVAGAVDIAKEYYLGITLDR
QRSQNVIMASTEGGVEIEEVAARSPEKILKVWVDPTIGLRPFQARQLAFGLGFEGNAFKQ
AVQFIQALYRAYEETDSSLAEINPLVLTKQGDVVAVDAKINLDDNALFRHPDLAELRDIH
EEDPLEVEASKYRLNYVRLTGNVGCMVNGAGLAMATMDLIKLAGGEPANFLDVGGGASPE
TVEAGFRIILKDPNVKVILVNIFGGIVRCDRVARGIVEAARKVQINVPLIVRLQGTNAEE
ARAILEQSGLEIETATLFKEVADKVNQALQRVAAA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcacgagtatcaggccaaggatattctgcaacgctatggcgtggccacgcag
cccggttatgtggcccgcaccgtggaggaagcggtcgaagccgcccgtcgcctgcagcag
gagcaggggtatgagctgttcgtggtgaaggcgcagattcacgccggcggtcgcggcaag
ggcgggggcgtcaagctggcgaagggtatcgaggaggtgcgcgagaaggccggcgccatt
ctgggcatgaacctggtcacgccccagacgggccctgagggacagaaagtgcgggccgtg
ctggtggccggtgccgtcgatattgcaaaggaatactatctgggcatcacgctggaccgc
cagcggagccagaacgtgatcatggcctcgacggaagggggcgtggagatcgaggaagtg
gccgcccggagccccgagaagatcctgaaggtgtgggtcgatcccacgatcggcctgcgt
ccgttccaggcacgccagctggccttcgggctgggcttcgagggcaacgccttcaaacag
gccgtccagttcatccaggcgctctatcgggcttacgaagaaaccgacagctcgctggcc
gagatcaacccgctcgtgctgacgaagcagggcgacgtggtggccgtcgatgccaagatc
aacctggacgacaacgcgcttttccggcatcccgatctggccgagctccgcgacatccac
gaagaagacccgctggaggtcgaggccagcaagtaccggctcaactacgtgcggctcacc
ggcaacgtaggctgcatggtgaacggagccggcctggccatggccacgatggacctgatc
aagctggcgggcggcgagccggccaacttcctggacgtgggcggtggggccagcccggag
accgtggaggccggcttccgcatcatcctgaaggacccgaacgtcaaggtgattctggtg
aatatcttcggcggcatcgtgcgctgcgaccgcgtcgcccgcggcatcgtcgaggcggcc
cgaaaggttcagatcaacgtgccgctgatcgtgcggctgcagggcaccaatgctgaagaa
gcgcgtgccattctggagcagagcggcctggaaatcgagacggccacgctcttcaaagag
gtggccgacaaggtgaaccaggcgctgcagcgcgtcgccgcagcctga

DBGET integrated database retrieval system