KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1096Help
Entry
Rhom172_1096      CDS       T01606                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00010  Glycolysis / Gluconeogenesis
rmg00052  Galactose metabolism
rmg00500  Starch and sucrose metabolism
rmg00520  Amino sugar and nucleotide sugar metabolism
rmg00521  Streptomycin biosynthesis
rmg01100  Metabolic pathways
rmg01110  Biosynthesis of secondary metabolites
rmg01120  Microbial metabolism in diverse environments
rmg01130  Biosynthesis of antibiotics
rmg01200  Carbon metabolism
Module
rmg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rhom172_1096
   00052 Galactose metabolism
    Rhom172_1096
   00500 Starch and sucrose metabolism
    Rhom172_1096
   00520 Amino sugar and nucleotide sugar metabolism
    Rhom172_1096
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rhom172_1096
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Rhom172_1096
Enzymes [BR:rmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rhom172_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEN73025
UniProt: G2SHL5
Position
complement(1270106..1271104)
Genome map
AA seq 332 aa AA seqDB search
MASIPPFAVGVDLGGTTIKAALVERGVGIQHELSRPTEAEEGPAHVIRRIAEMVQALIER
APNREIAGVGIGAPGTVNWERTAVIYPPNLPGWGIVDLRKELQEALGLALPIFVENDANL
AGLGSAHYGAGRPFDSFIMVTLGTGVGGAIIYRNRIFRGATGGAGEIGHMSIDYEGPLDR
YGIAGSVEAYIGQRFLSHYARYRLLTQRDSLVHQMAGEDLRDINPRILFEAAQAGDEPAR
EVLAWAGHKLGCVLAAAVNLLDIHKIVVGGGVSAAGDFILEPARQTLRRYVIPALRDRVE
IVRETLGNEAGMLGAAQLVFQLLEHPREDLEA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatcccgccttttgccgttggcgttgatctgggaggtaccaccatcaaggcc
gcgctggtggagcgcggcgtgggcattcagcacgaactgagccgccccaccgaggccgaa
gagggtccggcgcacgtcattcgccggatcgccgagatggtgcaggcgctcatcgaacgc
gcccccaaccgggagatcgcgggcgtcggcatcggcgcgccgggaaccgtcaactgggag
cgcaccgccgtcatctatccccccaacctgcccggctggggcatcgtcgatctgcggaag
gaactgcaggaagcactggggctggcgctgccgatcttcgtcgaaaacgacgcgaatctg
gccggactgggctcggcgcactacggggccggccgaccgttcgactcgttcatcatggtc
acgctgggcaccggcgtgggcggggccatcatctatcgaaatcgtatttttcgaggcgct
acaggtggtgccggcgaaatcggccacatgagcatcgactacgaagggccgctcgaccgc
tacggtatcgctggctcggtcgaggcctatatcggccagcgctttctctcgcactacgcc
cgctatcgcctgctgacgcaacgggacagcctggtgcatcagatggccggcgaggacctg
cgcgacatcaatccgcgcatcctcttcgaggccgcacaggccggcgacgaaccggcccgc
gaagtgctggcctgggccggtcacaagctgggctgcgtgctggcggcggccgtcaacctg
ctcgatatccacaaaatcgtggtgggcggtggcgtgtcggccgcgggcgacttcatcctg
gagcccgcccgccagaccctgcgccgctacgtgatccccgccctgcgtgaccgggtggaa
atcgtccgcgaaacgctgggcaacgaggccggcatgctgggcgccgcgcaactggtcttt
cagctcctggagcatccccgcgaagacctggaagcctga

DBGET integrated database retrieval system