KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1096Help
Entry
Rhom172_1096      CDS       T01606                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rhom172_1096
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rhom172_1096
   00052 Galactose metabolism
    Rhom172_1096
   00500 Starch and sucrose metabolism
    Rhom172_1096
   00520 Amino sugar and nucleotide sugar metabolism
    Rhom172_1096
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rhom172_1096
   00524 Butirosin and neomycin biosynthesis
    Rhom172_1096
Enzymes [BR:rmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rhom172_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1270106..1271104)
Genome map
AA seq 332 aa AA seqDB search
MASIPPFAVGVDLGGTTIKAALVERGVGIQHELSRPTEAEEGPAHVIRRIAEMVQALIER
APNREIAGVGIGAPGTVNWERTAVIYPPNLPGWGIVDLRKELQEALGLALPIFVENDANL
AGLGSAHYGAGRPFDSFIMVTLGTGVGGAIIYRNRIFRGATGGAGEIGHMSIDYEGPLDR
YGIAGSVEAYIGQRFLSHYARYRLLTQRDSLVHQMAGEDLRDINPRILFEAAQAGDEPAR
EVLAWAGHKLGCVLAAAVNLLDIHKIVVGGGVSAAGDFILEPARQTLRRYVIPALRDRVE
IVRETLGNEAGMLGAAQLVFQLLEHPREDLEA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatcccgccttttgccgttggcgttgatctgggaggtaccaccatcaaggcc
gcgctggtggagcgcggcgtgggcattcagcacgaactgagccgccccaccgaggccgaa
gagggtccggcgcacgtcattcgccggatcgccgagatggtgcaggcgctcatcgaacgc
gcccccaaccgggagatcgcgggcgtcggcatcggcgcgccgggaaccgtcaactgggag
cgcaccgccgtcatctatccccccaacctgcccggctggggcatcgtcgatctgcggaag
gaactgcaggaagcactggggctggcgctgccgatcttcgtcgaaaacgacgcgaatctg
gccggactgggctcggcgcactacggggccggccgaccgttcgactcgttcatcatggtc
acgctgggcaccggcgtgggcggggccatcatctatcgaaatcgtatttttcgaggcgct
acaggtggtgccggcgaaatcggccacatgagcatcgactacgaagggccgctcgaccgc
tacggtatcgctggctcggtcgaggcctatatcggccagcgctttctctcgcactacgcc
cgctatcgcctgctgacgcaacgggacagcctggtgcatcagatggccggcgaggacctg
cgcgacatcaatccgcgcatcctcttcgaggccgcacaggccggcgacgaaccggcccgc
gaagtgctggcctgggccggtcacaagctgggctgcgtgctggcggcggccgtcaacctg
ctcgatatccacaaaatcgtggtgggcggtggcgtgtcggccgcgggcgacttcatcctg
gagcccgcccgccagaccctgcgccgctacgtgatccccgccctgcgtgaccgggtggaa
atcgtccgcgaaacgctgggcaacgaggccggcatgctgggcgccgcgcaactggtcttt
cagctcctggagcatccccgcgaagacctggaagcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system