KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1258Help
Entry
Rhom172_1258      CDS       T01606                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rhom172_1258
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rhom172_1258
Enzymes [BR:rmg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Rhom172_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1444519..1445838)
Genome map
AA seq 439 aa AA seqDB search
MDKLVIEGGRPLRGTIPISGSKNTALMLMAGAVLADGVTVLENIPHLRDITTFSHVLRIA
GASVRFDPETHVMRIDATRIDFPEAPYELVKQMRASFYMLGALLGRCGQARVSLPGGCAW
GPRPVNLHLEGLRAFGAEIELDRGYVVARAPGGRLRGGRFRLDPPSVGATVNLLLGAVTA
RGSSRIENAALEPDVVVFGRALQQMGARIEGLGTRTIEVEGVDALQPITFRNCPDRIELG
TFMIASALAGTPGDTIYLTGAEPSHLGEAFLEAFRQTGAAFTFDGDTVAVSVPERLQAVS
IETAPYPGFPTDLQAQWTVLLSRAEGAGFVRDTVYPDRFKHVPELMRMGLQARVEGNTVF
LEGPQRLQGAHVMSTDLRGSVSLVLAGLVAEGETHVLRVYHLDRGYENLEGKLSAAGIAI
RRESYDEFATPASESAEES
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggataaactggtcatcgaaggcggccgtccgctccggggcacgatcccgatcagcggc
tcgaagaacacggcgctgatgctcatggccggggccgtgctggccgacggggtcaccgtg
ctggaaaacattccgcacctgcgcgacatcacgacgttctcccacgtcctgcgcattgca
ggcgcttcggtgcggttcgatccggaaacgcacgtcatgcgcatcgatgccacccgtatc
gactttcccgaggccccttacgagctggtcaagcagatgcgggcgtcgttctacatgctg
ggcgcgctgctgggccgctgcggacaggcgcgcgtgtcgctgccgggcggctgcgcctgg
ggcccgcgcccggtcaacctgcacctggagggactgcgcgccttcggcgccgagatcgag
ctggaccggggctacgtggtggcccgcgcgcccggcggccggctgcgcggcggccgcttt
cggctcgatccgcccagcgtcggcgccacggtgaacctgctgctgggcgccgtcacggcc
cgcggcagctcccgcatcgagaacgccgcgctcgaacccgacgtggtcgtctttggccgg
gcgctgcaacagatgggcgcccgcatcgaaggactgggcacgcgtacgatcgaggtggaa
ggcgtcgacgccctgcaacccatcaccttccgcaactgccccgaccgcatcgaactgggc
acgttcatgatcgcctccgcccttgcaggaacgcccggcgacacgatctacctgaccggc
gccgagccgtcccacctgggcgaagcgtttctggaggcctttcgccagactggcgccgcc
ttcaccttcgatggcgacacggtggccgtctccgtccccgaacggctgcaggccgtttct
atcgagacggcaccctatccgggttttccgaccgatctgcaggcgcagtggaccgtcctg
ctctcgcgggccgaaggcgccggcttcgtgcgcgataccgtctatccagatcgcttcaag
cacgtccccgaactcatgcgtatggggctacaggcacgcgtcgagggcaacacggtcttt
ctggaagggccgcagcgcctgcagggtgcgcacgtgatgagcaccgacctgcgcggcagc
gtttcgctggtgctggcgggtctggtggccgaaggcgaaacgcacgtgttgcgcgtctac
cacctcgaccgcggctacgaaaacctcgaaggcaagctgtcggccgccggcattgccatc
cgccgcgaaagctacgacgagtttgctacccctgcctccgaatcagccgaagaaagctga

DBGET integrated database retrieval system