KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1284Help
Entry
Rhom172_1284      CDS       T01606                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rhom172_1284
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Rhom172_1284
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rhom172_1284
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Rhom172_1284
Exosome [BR:rmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rhom172_1284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1472531..1473898
Genome map
AA seq 455 aa AA seqDB search
MRWVLLLLLMLLGFGEKAWSQSPRPKNLILMIADGCGPASVTMARDYARAVLGRDALALD
AIQTGAVRTGSASSRVTDSAAGATAYACGVKTYNGAIAVDSAGRPLATLLEAAKARGMAT
GLVATSRITHATPAAFAAHVPQRAMESEIAAQMLAQRVDVLLGGGWSYFLPTSEGGRRQD
GRNLLREAEAMGYQVVRTAADFRQGVRRPVLGLFGPSHLPYEIDRDPEEVPSLAEMTRVA
LELLVDDPDGFFLMVEGSRIDHAGHANDAAAHVREVLAYDEAVAVALDFARRDGQTLVVS
VADHETGGLSLGRNVDGRGVYDWHPDVLARVQVSYERLIPALRRSERPDALLQAWLGLDS
LRADERALVAQATAEPDTWPEVLTELIGRRAVVGWTSNGHTAVDVNLYAFGPGAERLMGS
FENDEIGRLLAELMGFDLPALTETLRQEEAVGESH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgggtattgctgttgttgctgatgctgttggggttcggagaaaaggcctggtcc
cagtcgccgcgcccgaagaacctgatcctgatgattgccgacggttgtggtccggccagc
gtcacgatggcccgcgactatgcccgggccgtgctgggacgcgacgcgctggcgctggat
gccattcagaccggcgcggtgcggaccggctcggcctccagccgggtaaccgactcggcc
gccggcgcgacggcctatgcctgcggcgtcaaaacctacaacggcgcgatcgccgtcgac
tcggccggacgtccgctggccacgttgctggaggctgcaaaggcgcgtggaatggcgacc
ggactggtggcgaccagccgaatcacgcatgccacgccggccgcctttgccgcccatgtg
ccgcagcgcgccatggaaagcgagatcgccgcgcagatgctggcgcaacgcgtcgacgtg
ctgctggggggtggctggagctatttcctgccgacttcggagggcggacgcagacaggac
ggccgcaacctgctgcgcgaagccgaagcgatgggctaccaggtggtgcgtacggctgcc
gacttccgtcagggggtgcggcgtccggtgctgggactgttcgggccgagtcatctgccc
tacgagatcgaccgcgatccggaagaggtcccctcgctggccgagatgacccgcgtagcc
cttgagctgctggtggacgatccggacggcttcttcctgatggtggagggcagccgcatc
gaccacgccggacatgccaacgacgccgccgcccacgtccgcgaagtgctggcctacgac
gaggccgtagccgtggcactcgactttgcccgtcgtgacggtcagacgctcgtcgtctcg
gtggccgaccacgagacgggcggtctgtcgctgggacgcaacgtggacggccgcggcgtc
tacgactggcacccggacgtgctggcccgcgtgcaggtgtcttacgaacggcttatcccg
gcgctgcgtcgttcggagcggcccgacgcgctcctgcaggcctggctcgggctcgacagc
ctgcgtgccgacgagcgggcgctcgtcgcgcaggccacggccgagcccgacacctggccc
gaggtgcttaccgaactaatcggacgccgggccgtcgtgggctggacctcgaatggccat
accgccgtggacgtcaacctgtacgccttcgggcccggcgccgaacggctgatgggcagc
ttcgaaaatgacgaaatcggccgactgctggccgaactcatgggcttcgacctgccggct
ctgaccgagacgctccggcaggaggaagccgtcggcgaaagccactga

DBGET integrated database retrieval system