KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1337Help
Entry
Rhom172_1337      CDS       T01606                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00260  Glycine, serine and threonine metabolism
rmg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rmg01100  Metabolic pathways
rmg01110  Biosynthesis of secondary metabolites
rmg01130  Biosynthesis of antibiotics
rmg01230  Biosynthesis of amino acids
Module
rmg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rhom172_1337
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rhom172_1337
Enzymes [BR:rmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rhom172_1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEN73264
UniProt: G2SF43
Position
1539198..1540571
Genome map
AA seq 457 aa AA seqDB search
MEESVKILLPESELPTHWYNLNADLGALGVELPPVLHPGTKQPVGPADLAPLFPEALIAQ
EVSTERYIEIPEPVRDIYRLWRPTPLFRARRWEKALDTPARIYYKYEGVSPTGSHKPNTA
VPQVYYNAQEGVRRITTETGAGQWGSALSFACQVFGLECKVYMVRVSYEQKPYRRVLMQA
WGATVVPSPSTETEAGRRVLAEDPDSTGSLGIAISEAVEEAATRNDTKYALGSVLNHVLL
HQTVIGQEVIRQLERAGADWPDVIVGCVGGGSNFAGFAFPFLVERVRSGRTTRIVAVEPA
AAPSLTRGVYAYDFGDTARLTPLVKMYTLGHDFIPAPIHAGGLRYHGMSPQVSALYAAGL
IEARSVPQNPMFAAALSFARSEGIVPAPEAGHAVWGAMQEALAAREAGEARTIVFNLCGH
GHFDLSAYEAYLAGKLEDYEYPEEAVRKSLEALPQID
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatcggtaaaaatcctgctcccggagtcggagctgcccacccactggtacaat
ctgaatgccgatctgggtgcactgggcgtcgaattgccgcccgtgctgcatcccggcacg
aagcaaccggtgggaccggccgatctggccccgctgtttcctgaagcgctcatcgctcag
gaggtgagcaccgaacgctacatcgagattcccgagcccgtgcgcgacatctaccggctc
tggcggcccacgccgctgtttcgcgcccgccgctgggaaaaggcgctcgacacgcccgcc
cgcatctactacaagtacgaaggcgtgagtcccacgggtagccacaagcccaacacggcc
gtcccgcaggtctactacaacgcgcaggaaggcgtgcggcgcatcacgacggagaccggc
gccgggcaatggggaagcgcgctgagcttcgcctgtcaggtgttcgggctggagtgcaag
gtgtacatggtgcgcgtgagctacgagcagaagccctaccgtcgcgtgctcatgcaggcc
tggggcgcgacggtggtgccgagcccgagcaccgagacggaagccggccgccgtgtgctg
gccgaagaccccgacagcacgggcagtctgggcatcgccatcagcgaggccgtcgaggaa
gcggctacgcgcaacgacacgaagtacgcgctgggcagcgtgctcaaccacgtgctgctg
caccagacggtcatcgggcaggaggtgatccgccaactcgaacgggccggcgccgactgg
cccgacgtgatcgtcggttgcgtgggcggcgggagcaactttgccggctttgcctttccg
ttcctggtcgagcgcgtgcgctccggccgtacgacgcgcatcgtggccgtcgagccggcg
gctgcaccttcgctgacgcggggcgtctatgcctacgacttcggcgacacggcccgcctg
acgccgctcgtgaagatgtacacgctcgggcacgacttcatcccggcgcctattcatgcc
ggcggcctgcgctaccacgggatgagtccgcaggtgagcgcgctctatgcggccgggctg
atcgaggcgcggagcgtgccccagaacccgatgtttgcggcggcgctgagctttgcgcgc
agcgaagggatcgtgccggcgccggaagccgggcacgccgtctggggggccatgcaggag
gccctggcggcccgcgaagccggcgaggcgcgcacgatcgtcttcaacctgtgcggccat
ggacacttcgatctgagcgcctacgaggcctatctggccggtaagctcgaagactacgag
tacccggaagaggccgtccgcaagagcctggaggcgctgccgcagatcgactga

DBGET integrated database retrieval system