KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1408Help
Entry
Rhom172_1408      CDS       T01606                                 

Definition
dTDP-4-dehydrorhamnose 3 5-epimerase-like protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rhom172_1408
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rhom172_1408
Enzymes [BR:rmg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rhom172_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1614286..1614759
Genome map
AA seq 157 aa AA seqDB search
MNWKEGPIEGVVIRPLKRYEDARGWLAEFFRQDELDPSLHPVMGYVSLTHPGITRGPHEH
REQTDLFVFFHGHLRLYLWDARPDSPTYGHRQVLDVGEAHPVTALVPPGVVHAYRNVGHT
PALLVNCPNRLYAGWGRREPVDEIRHENRPDHPFHMD
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaactggaaagaaggtccaatcgaaggcgtcgtcatccgaccgctcaagcgctacgaa
gacgcccgcgggtggctggccgagttttttcggcaggacgaactggacccgtcgctccat
cccgtcatgggatatgtttcgctgacccatcccggcatcacgcgcggtccgcacgagcac
cgggagcagacggacctgttcgtgtttttccacggtcacctgcggctgtatctgtgggat
gcccggcccgactcgcccacctacggccaccgacaggtgctcgacgtcggcgaggcccat
ccggtcaccgcgctggtgccacccggcgtggtgcatgcctaccgcaacgtcggccatacg
cccgccctgctggtcaactgtccgaaccggctctacgccggatggggccgccgggaaccc
gtcgatgagatccgccacgaaaaccggccggatcatcccttccacatggactga

DBGET integrated database retrieval system