KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1412Help
Entry
Rhom172_1412      CDS       T01606                                 

Definition
exodeoxyribonuclease 7 large subunit
Orthology
K03601  
exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Mismatch repair
Class
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:rmg03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1617102..1618322
Genome map
AA seq 406 aa AA seqDB search
MQSAFDFAFEPRVWRVGELAEALCETVESLYDELIVEGELSNFRRHRQSGHCYFTLQDGE
AQLRCVMWASRVQRLYFRPEDGHQVQVHGRLTFYKPRGELQLIATSMTLAGAGARQQAFE
ALKRRLEAEGLFDPNQKRPLPRFPRRIGVVTSDSGAALQDILSILRRRFPVVEVLHCPVR
VQGLQAAPSIARAIRLMNRLPEDRRPDVLIVGRGGGSVEDLWAFNEEVVARAIFASHIPV
ISAVGHETDVSIADLVADRRAATPSMAAEIAVPDRDELEAMLIRTAQIMRQYLRQGLDRR
RQRVHMLLHHYGLRRVPDRLARMQDELQRLEASLQQQVRQLLERRRQTLALLQSRLAAFD
PQLPLRRGYVRVRCNGSLATRAHQLRPGDAVTLEFYDGRHDARIIS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctgcatttgattttgccttcgagccgcgcgtctggcgggtcggcgaactggcc
gaggcgctctgcgagacggtcgaatcgctctacgacgaactgattgtcgaaggtgaactc
tcgaattttcggcggcaccggcaaagtggccactgctactttacgctgcaggatggcgag
gcgcagcttcgctgcgtcatgtgggccagccgggtgcagcggttgtacttccggccggaa
gacggccaccaggtacaggtccatggccgtctgacgttctacaagccccggggcgagctg
cagttgatcgctacctccatgacgcttgccggggccggcgcccgccagcaggccttcgag
gcgctcaagcgcaggctggaggccgaagggctgttcgatccgaaccaaaagcgtccgctt
ccacgctttcctcgacggatcggcgtcgtcacctccgacagcggtgctgcgttgcaggat
attctcagcattctgcgtcgccgctttcccgtcgtcgaggtgctgcactgcccggtgcgt
gtgcaggggttgcaggcggcgccgtcgatcgcccgcgccatccggctgatgaaccggcta
ccggaggatcgccgtccggacgtgctcattgtgggacgcggcggcggatcggtggaagac
ctgtgggccttcaacgaggaagtggtcgcccgggcgattttcgcctcccacatccctgtc
atcagcgccgtcggacacgaaacagacgtatcgattgcggatctggtggccgaccggcgg
gcggccacgccgtcgatggcggccgagatcgccgtaccggatcgggacgaactggaagcc
atgctgatccgcaccgcccagatcatgcgtcagtacctccggcagggcctcgatcggcgg
cgccagcgtgtgcacatgctgttgcaccactacggcctgcgccgcgtcccggaccggttg
gcccgtatgcaggacgagctgcaacggctggaagcctcgctgcagcaacaggtccggcaa
cttctggaacggcgtcggcagacgctggccctgctgcagagccgcctggccgctttcgat
ccgcaacttcccctgcgtcgcggctacgtgcgcgtgcggtgcaacggtagcctcgccacc
cgtgcgcatcagctccgacccggcgacgcggtcacgctcgaattctatgatggccggcac
gacgcccgcatcatctcctga

DBGET integrated database retrieval system