KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1412Help
Entry
Rhom172_1412      CDS       T01606                                 

Definition
exodeoxyribonuclease 7 large subunit
Orthology
K03601  
exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    Rhom172_1412
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     Rhom172_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1617102..1618322
Genome map
AA seq 406 aa AA seqDB search
MQSAFDFAFEPRVWRVGELAEALCETVESLYDELIVEGELSNFRRHRQSGHCYFTLQDGE
AQLRCVMWASRVQRLYFRPEDGHQVQVHGRLTFYKPRGELQLIATSMTLAGAGARQQAFE
ALKRRLEAEGLFDPNQKRPLPRFPRRIGVVTSDSGAALQDILSILRRRFPVVEVLHCPVR
VQGLQAAPSIARAIRLMNRLPEDRRPDVLIVGRGGGSVEDLWAFNEEVVARAIFASHIPV
ISAVGHETDVSIADLVADRRAATPSMAAEIAVPDRDELEAMLIRTAQIMRQYLRQGLDRR
RQRVHMLLHHYGLRRVPDRLARMQDELQRLEASLQQQVRQLLERRRQTLALLQSRLAAFD
PQLPLRRGYVRVRCNGSLATRAHQLRPGDAVTLEFYDGRHDARIIS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctgcatttgattttgccttcgagccgcgcgtctggcgggtcggcgaactggcc
gaggcgctctgcgagacggtcgaatcgctctacgacgaactgattgtcgaaggtgaactc
tcgaattttcggcggcaccggcaaagtggccactgctactttacgctgcaggatggcgag
gcgcagcttcgctgcgtcatgtgggccagccgggtgcagcggttgtacttccggccggaa
gacggccaccaggtacaggtccatggccgtctgacgttctacaagccccggggcgagctg
cagttgatcgctacctccatgacgcttgccggggccggcgcccgccagcaggccttcgag
gcgctcaagcgcaggctggaggccgaagggctgttcgatccgaaccaaaagcgtccgctt
ccacgctttcctcgacggatcggcgtcgtcacctccgacagcggtgctgcgttgcaggat
attctcagcattctgcgtcgccgctttcccgtcgtcgaggtgctgcactgcccggtgcgt
gtgcaggggttgcaggcggcgccgtcgatcgcccgcgccatccggctgatgaaccggcta
ccggaggatcgccgtccggacgtgctcattgtgggacgcggcggcggatcggtggaagac
ctgtgggccttcaacgaggaagtggtcgcccgggcgattttcgcctcccacatccctgtc
atcagcgccgtcggacacgaaacagacgtatcgattgcggatctggtggccgaccggcgg
gcggccacgccgtcgatggcggccgagatcgccgtaccggatcgggacgaactggaagcc
atgctgatccgcaccgcccagatcatgcgtcagtacctccggcagggcctcgatcggcgg
cgccagcgtgtgcacatgctgttgcaccactacggcctgcgccgcgtcccggaccggttg
gcccgtatgcaggacgagctgcaacggctggaagcctcgctgcagcaacaggtccggcaa
cttctggaacggcgtcggcagacgctggccctgctgcagagccgcctggccgctttcgat
ccgcaacttcccctgcgtcgcggctacgtgcgcgtgcggtgcaacggtagcctcgccacc
cgtgcgcatcagctccgacccggcgacgcggtcacgctcgaattctatgatggccggcac
gacgcccgcatcatctcctga

DBGET integrated database retrieval system