KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1451Help
Entry
Rhom172_1451      CDS       T01606                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00010  Glycolysis / Gluconeogenesis
rmg00020  Citrate cycle (TCA cycle)
rmg00620  Pyruvate metabolism
rmg01100  Metabolic pathways
rmg01110  Biosynthesis of secondary metabolites
rmg01120  Microbial metabolism in diverse environments
rmg01130  Biosynthesis of antibiotics
rmg01200  Carbon metabolism
Module
rmg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rhom172_1451
   00020 Citrate cycle (TCA cycle)
    Rhom172_1451
   00620 Pyruvate metabolism
    Rhom172_1451
Enzymes [BR:rmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rhom172_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Peptidase_M23 HlyD_3 QRPTase_N DUF2118 AKAP7_RIRII_bdg
Motif
Other DBs
NCBI-ProteinID: AEN73375
UniProt: G2SHQ9
Position
complement(1653944..1655263)
Genome map
AA seq 439 aa AA seqDB search
MAIPIEMPKMSDTMEEGVLVAWLVEEGQRVSAGDVIAQVETDKATMDLEVYDDGVLLKKV
VKEGESVPIGGLIAVLGEEGEDISEILERYSGQKEAPAQAEPAPEAAPAEAAPQAEQPAR
AGDGAPAPAVTAGDGAETRIKASPLARKLAREYGLDLRTIQGTGPEGRIVRRDIEAALAR
QRPSVEVAAPTPEAAPAPAPTPTPAPELPYESVPITPMRRTIARRLAQSKFTAPHFYLTV
DVDVEKAIAFRQQLNELAEAQERPKISFNDLITKACALALRQHPEINASYLEQEGEIRRW
KEIHIGIAVALEDGLVTPVIRNADQKGLGQIAEETRALAEKARQRKLQPQEMEGATFTTS
NLGMYGIEEFTAIINPPNACILAIGAIRDVPVVKNGMIVPGKRMRLTLSCDHRIVDGATG
ARFLKTVQQYLEEPLNLLL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcgattcccattgaaatgcccaagatgagcgacacgatggaggagggggtgctggtg
gcgtggctggtggaagaagggcagcgcgtgtcggccggggacgtgatcgctcaggtggaa
acggataaagccacgatggacctcgaagtgtacgacgacggggtcctgctgaagaaagtg
gtcaaagaaggcgaatcggtccccatcggtggcctgatcgccgtgctgggggaagaaggc
gaagacatttcggagattctggagcgctacagcggccagaaagaggcgcccgcgcaggcg
gagccggcgccggaggctgcaccggccgaagcggcgccgcaggccgagcagccggcccgc
gcgggggatggcgctccggctcccgcggtgacggccggcgacggcgctgagacgcgcatc
aaggcctcgccactggcgcgtaagctggccagagagtacgggctggacctgcgcaccatt
cagggcacgggacccgaggggcgtattgtgcgccgcgacatcgaggcggcgctggcccgt
cagcgtccgtccgtcgaagtggccgcaccgacacccgaagccgcgcctgcaccggccccg
acgcccacgccggcgcccgagctgccctacgagtcggtgcccatcacgccgatgcgccgc
acgatcgcgcggcggctggcgcagagcaaattcacggcgccgcatttctatctgaccgtc
gacgtggacgtcgagaaagccatcgccttccgccagcagctcaacgagctggccgaagcg
caggaacggcccaagatctccttcaacgacctgatcaccaaggcctgcgcgctggcgctg
cgccagcatcccgagatcaacgcttcctacctggagcaggaaggcgaaatccggcgctgg
aaggaaattcatatcgggattgccgtggcgctggaagacgggctggtgacgccggtcatc
cgcaatgccgaccagaaagggctgggccagatcgccgaagagacgcgcgcgctggccgag
aaagcccgccagcgcaaactgcagccccaggaaatggaaggggcgaccttcaccacgagc
aacctggggatgtacggcatcgaggaattcacggccattatcaatccgccgaacgcctgc
atcctggccatcggcgccatccgcgacgtgcccgtggtgaagaacggcatgatcgtgccc
ggcaagcggatgcggctgaccctctcgtgcgatcaccggatcgtcgatggcgctaccggc
gcccgcttcctcaagaccgtccagcagtacctggaagagccgctgaacctgctgctgtaa

DBGET integrated database retrieval system