KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1455Help
Entry
Rhom172_1455      CDS       T01606                                 

Definition
alkaline phosphatase D-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rhom172_1455
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Rhom172_1455
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rhom172_1455
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Rhom172_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1658538..1659914
Genome map
AA seq 458 aa AA seqDB search
MRRCLLFLCGLWGLLGVAVAQVPVRLPETLPVAELLRSGPMNGYATQREVVVWLQTWAPA
QVQLLYREEGQPEDSARITPPYFAGPETDYTVHISVPYLEPGRRYVYDVVLNDTILALPY
QPRFQTQPLWQWRTDPPTFTVAAASCFYVNDPPYDRPGQPYGGDFQILTHLTRLRPDVMI
WLGDNTYLREADFGSPTMMSYRYAHTRSHPLLQELLATAHHYAIWDDHDYGPNDADRSYV
LKGAALRLFQQYWANPSYGLPGTPGVFTQFTWGDVDFFLLDDRFYRSPNDAPDDSTKTMW
GEAQLTWLIDALTYSRAPFKIVANGNQILNRSTRFESVAARFPRDYERLLREIVRRGISG
VVFLSGDRHHTELLRYEPEGFYPLYEITTSPLTAGPSNVEEDNPLRVEGTLLRERNVVLL
TFSGPRTDRVLTITAYDAQGQERWRHTIRARELRPPRP
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgctgcctgcttttcctctgcgggctctgggggctcctcggagtggccgtggcc
caggtgcccgtccggctacccgagacgcttcccgtagccgagctgctgcgctcgggtccg
atgaacggctacgccacgcaacgcgaggtcgtcgtctggctgcagacgtgggcgccggct
caggtgcagctgctctaccgcgaagagggccagcccgaagacagcgcacgcatcaccccg
ccgtactttgccggccctgagacggactacaccgtgcacatctccgtgccctatctggag
ccgggccgccgctacgtttacgacgtggtgctcaacgacacgatcctggcgctcccctac
cagccacgcttccagacgcaaccgctctggcagtggcgcaccgatccgcccacgttcacc
gtggccgcggcgtcctgcttctacgtgaacgatccgccctacgaccgccccggccagccc
tacggcggcgacttccagatcctcacgcacctgacgcgcctccgccccgacgtgatgatc
tggctgggcgacaacacctacctgcgcgaggcggacttcggcagcccgaccatgatgtct
taccgctacgcgcacacccgcagccatccgttgctgcaggagctgctcgccacggcccac
cactacgccatctgggacgaccacgactacggccccaacgacgccgaccggagctatgtg
ctcaaaggcgccgcactgcgcctcttccagcagtactgggccaatccgtcctatggcctg
cccggcacgcccggcgtcttcacccagttcacctggggcgacgtggacttcttcctgttg
gacgaccgcttttaccggagtcccaacgacgccccggacgattccaccaagaccatgtgg
ggcgaggcccagctcacctggctcatcgacgcgctcacctacagccgcgcacccttcaag
atcgtcgccaacggcaaccagatcctcaaccgctccacccgcttcgagtcggtggccgcc
cgctttccgcgcgattacgagcggctgctccgggaaatcgtacgccgcggcatctccggc
gtggtattcctgagcggcgaccgccaccacaccgagctgctgcgctacgagccggaaggc
ttctatccgctctacgagatcaccacctcgccgctgacggcaggcccctcgaacgtggaa
gaagataatccgctgcgcgtcgaaggcaccctgctacgcgagcgcaacgtggtgctgctc
accttctccgggccacgcaccgaccgcgtgctgacgatcaccgcctacgacgcccagggc
caggaacgctggcgccacacgatccgggcccgggagctgcgaccgccccgaccgtga

DBGET integrated database retrieval system