KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1487Help
Entry
Rhom172_1487      CDS       T01606                                 

Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rmg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rmg00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rmg00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rmg00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rmg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1694033..1696024
Genome map
AA seq 663 aa AA seqDB search
MQTGSAFSLTTGTFPFNQPVVWEPRPEWIAASNLQRFMNRHGIGSLDELQARSVDNPEWF
WPAVLEDLDIRFYRPYTRILDLSEGPAFPRWCVGGQLNIVHNLLDKWQETNAAERIALRW
EGEEGTLRTLTYAGLHAEVCRCARALQSLGFQKGDVAALFMPMTPELVIAFLAVIKLGGI
VLPLFSGYGAEAVRTRIRDAEARFLFTADGFYRRGRPVYLKPVADEALADCPSVQHVIVY
RRMEADNVPVPMLPGRDHWWHELVWPQPAEAETVRTDAEDVLMVIYTSGTTGRPKGAVHT
HCGFPVKAAQDMYQCMDLKPGETMYWVTDMGWMMGPWLVFGTLLIGATMVLYDGAPDYPD
VDRLWGLVEQHRVTHLGISPTLIRALRPHGPEPIRRHDLSSLRAVGSTGSPWDPESWLWC
FEHVLGREKPILNYSGGTEISGGILCGNFFRPLKPCAFSGPVPGMAADVVDEQGRPVREA
VGELVIRKPWIGMTRGFWRDRERYLDTYWRRIEGLWVHGDFAAIDRDGLWYILGRSDDTI
KVAGKRLGPAEVEAILNAHEAVAESAAIGVPHEVKGEEVVAFVVLKPGVSPSEELRQELM
ERVVAALGKPLKPREIRFTTALPKTRNAKIMRRVIRAAYLGQDPGDVSSLEDPAAVEAIR
QAV
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccggaagcgcttttagtttgaccaccggcacctttcccttcaaccagcccgtg
gtctgggagccgcggccggagtggatcgcggccagcaacctgcagcggttcatgaaccgc
cacggcatcggttcgctcgacgagctgcaagcccgctcggtcgacaacccggagtggttc
tggccggccgtgctggaagatctggacattcgcttctaccgaccttacacgcgcattctg
gatctgagcgaaggaccggccttcccgcgctggtgcgtgggtggccagctcaacatcgtc
cacaacctgctggacaaatggcaggagacgaacgcggccgaacgtatcgcgctgcgctgg
gaaggcgaagaaggtacgctgcgcacgctgacctacgcgggcctgcacgccgaggtgtgc
cgctgcgcccgcgccctgcagtcgctgggcttccagaaaggcgacgtggccgcgctcttc
atgccgatgacgcccgagctggtcatcgccttcctggccgtgatcaagctgggcgggatc
gtgctgccgctcttcagcggctacggcgccgaggccgtccgcacccgcatccgggacgcc
gaagcacgctttctgttcacggccgacggtttctaccggcgcggccgcccggtctacctg
aagcccgtggccgacgaagcgctggccgactgcccgagcgtgcagcacgtgatcgtctac
cgccgcatggaggccgacaacgtaccggtgcccatgctcccgggccgcgaccactggtgg
cacgagctggtctggccgcaaccggccgaggccgagacggtccgcaccgacgccgaagac
gtgctcatggtcatctacacgagcggcaccacgggccgcccgaaaggggccgtccacacg
cactgcggctttccggtcaaggccgcccaggacatgtaccagtgcatggacctcaagccg
ggcgaaaccatgtactgggtgaccgacatgggctggatgatgggcccctggctggttttc
ggcacgctgctcatcggggccacgatggtgctctacgacggcgcgcccgactacccggac
gtcgatcggctctggggactggtcgaacagcaccgggtaacgcatctgggcatctcgccc
acgctgatccgggcgctgcggccgcatggtccggagcccattcgccgccacgatctgtcg
agcctccgggcggtgggttcgaccggtagtccctgggacccggaatcctggctctggtgc
ttcgagcacgtgctcggccgcgaaaagcccattctcaactactcgggcggcacggagatc
tccggcgggattctctgcggcaactttttccgtccgctcaaaccctgcgcgttctcgggt
ccggtacccggtatggccgccgacgtggtggacgagcagggacgccccgtgcgcgaggcc
gtcggcgagctggtcatccgcaagccctggatcggcatgacgcgcggcttctggcgcgac
cgcgaacgctaccttgacacctactggcgccgcatcgaaggactctgggtacacggcgat
tttgccgccatcgaccgcgacggcctctggtacatcctgggccgctcggacgacacgatc
aaggtggccggcaagcgcctgggtccggccgaagtcgaggccatcctgaacgcccacgaa
gccgtggccgaaagtgcggcgatcggcgtcccgcacgaggtcaaaggcgaagaagtggta
gccttcgtcgtcctgaagcccggcgtttcaccctccgaagaactccgccaggaactcatg
gagcgcgtggtagcggcactgggcaaacccctgaagccccgcgagatccggttcaccacg
gccctgcccaagacgcgcaacgccaagatcatgcgccgtgtgatccgggccgcgtatctc
ggtcaggatccgggcgacgtgagcagcctcgaagatccggccgccgtcgaggccatccgc
caggccgtctga

DBGET integrated database retrieval system