KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1527Help
Entry
Rhom172_1527      CDS       T01606                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00071  Fatty acid degradation
rmg00280  Valine, leucine and isoleucine degradation
rmg00281  Geraniol degradation
rmg00310  Lysine degradation
rmg00362  Benzoate degradation
rmg00380  Tryptophan metabolism
rmg00410  beta-Alanine metabolism
rmg00640  Propanoate metabolism
rmg00650  Butanoate metabolism
rmg00903  Limonene and pinene degradation
rmg00930  Caprolactam degradation
rmg01040  Biosynthesis of unsaturated fatty acids
rmg01100  Metabolic pathways
rmg01110  Biosynthesis of secondary metabolites
rmg01120  Microbial metabolism in diverse environments
rmg01130  Biosynthesis of antibiotics
rmg01200  Carbon metabolism
rmg01212  Fatty acid metabolism
Module
rmg_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rhom172_1527
   00650 Butanoate metabolism
    Rhom172_1527
  Lipid metabolism
   00071 Fatty acid degradation
    Rhom172_1527
   01040 Biosynthesis of unsaturated fatty acids
    Rhom172_1527
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rhom172_1527
   00310 Lysine degradation
    Rhom172_1527
   00380 Tryptophan metabolism
    Rhom172_1527
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rhom172_1527
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rhom172_1527
   00281 Geraniol degradation
    Rhom172_1527
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rhom172_1527
   00930 Caprolactam degradation
    Rhom172_1527
Enzymes [BR:rmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rhom172_1527
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rhom172_1527
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rhom172_1527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 2-Hacid_dh_C F420_oxidored DUF1731
Motif
Other DBs
NCBI-ProteinID: AEN73447
UniProt: G2SJ69
Position
complement(1737278..1739419)
Genome map
AA seq 713 aa AA seqDB search
MTEQTQPAIRYERDADGIVTLTMDMPGRSANVINEVLAEAVAAALDRLEQEKDAISGVIL
TSARSTFLAGADLEGLLALRDPAEAFRRAEQFKALLRRLETLGRPVVAAINGTALGGGME
LALACHRRIVRDDPSIRLGFPEVTLGLIPGGGGITRLVRLLGLEAAHPYLIEGRQVSPRE
ALAAGLVHELAESNDALLEKARAWILSRPDPTQPWDRPDYRMPGGDPRHPRMMQMLAVAP
AMLRKQTWGNYPAPEAILSAAVEGALVTFDTASRIESRYFARVATGQVAKNMIQTFWFQL
NEINKGRSRPSGVPPTDTKKVGVLGAGLMGHGIAYVTALAGMEVVLKDLTLEKAEAGKAR
IAKLLDERMAKGRLLPEEKQAVLDRIRTTDRVEDLAGCDLVIEAVFENRDVKAQVIRETE
AVLPEDAVFGSNTSTIPITSLAAYSKRPHRFVGIHFFSPVHRMRLVELIRGRQTSDEALA
KAFDYVRKIGKTPIVVNDSRGFYTSRVFGTYLNEGLALLAEGQHPRAIEVAGRQAGMPIG
PLAVADEVSLQLMQHIREQTEKDLAVEGKTLPPHPAYRVLDVMVREHGRLGKAHGAGFYE
YPKDGPKYLWPELRRLFPPQGEPLPQQEMIDRLLFVQALETVRCLDEGVLTSVADANIGS
VFGWGFAPFHGGTLQFINAYGLERFVARAEALAARYGERFTPPERLRDNGPPR
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacagacgcaaccggccattcgctacgagcgcgacgccgacgggatcgtcacg
ctgacgatggacatgccggggcgctcggcgaacgtgatcaacgaagtgctggccgaagcg
gtggcggccgcgctcgatcggctggaacaggaaaaagacgccatcagcggcgtgatcctg
acttcggccagatccacgtttctggccggggccgatctggaagggctgctggcgttgcgc
gatccggccgaggcgttccgccgcgccgagcagttcaaggcgctgctccggcgcctggag
acgctggggcgtcccgtggtggccgccatcaacgggacggcactcggcggcggcatggag
ctggcgctggcctgccatcggcgcatcgtgcgcgatgatccatccatccgactgggcttc
ccggaggtgacgctcggcctgattcccgggggtggcggcatcacccggctggtgcggctg
ctggggctggaggccgcgcatccctacctgatcgaaggccgccaggtgtcgcctcgcgag
gcgcttgcagcgggtctggtgcacgaactggccgaaagcaacgacgcgctgctggaaaag
gcccgcgcctggattctttcacgtcctgatcccacgcagccctgggaccggccggactac
cggatgccgggcggcgacccccgccatccgcgcatgatgcagatgctggccgtggcaccg
gccatgctccgcaagcagacctggggcaactatccggcgcccgaggccatcctgagcgct
gccgtcgaaggcgcgcttgtgacgttcgacacggccagccgcatcgagtcgcgctacttc
gctcgcgtggccaccggccaggtggcgaagaatatgatccagacgttctggtttcagctc
aacgagatcaacaaagggcgcagccgtccgtccggtgtgccgcccaccgacacgaagaaa
gtcggtgtgctcggggccggtctgatgggccacggcatcgcttacgtgacggccctggcg
ggtatggaggtggtgctgaaggacctgacgctggaaaaggccgaggccggcaaggcccgc
atcgcgaagctgctcgacgaacgcatggcgaagggacgtctcttgcccgaagagaagcag
gccgtgctcgaccgcatccgcacgaccgaccgcgtcgaggacctggccgggtgcgatctg
gtgatcgaggcggtcttcgaaaaccgggacgtcaaggcacaggtcatccgcgaaaccgaa
gcagtgctgcccgaagacgccgtcttcggatcgaacacctcgacgatccccattaccagc
ctggccgcctattcgaagcgcccgcatcggttcgtgggcatccacttcttctcgccggtg
caccgcatgcggcttgtcgagctgatccgcgggcgccagacctcggacgaagcgctggcg
aaagccttcgactacgtgcgtaagatcggcaagacgccgatcgtggtgaacgacagtcgc
ggcttctacacgtcgcgcgtcttcggcacctacctgaacgaagggctggcgctgctggcc
gaaggtcagcatccgcgggccatcgaggtggcgggccgccaggccggcatgcccatcgga
ccgctggccgtggccgacgaggtgagcctccagctcatgcagcacatccgcgagcagacc
gagaaagacctggcggtcgagggcaagacgctcccgccgcatccggcctatcgggtgctc
gacgtgatggtgcgcgaacacggccggctcggtaaggcgcacggtgcgggcttctacgag
tatccgaaggacggccccaaatacctgtggccggagttgcgacggctcttcccgccgcag
ggtgagccgctgccgcagcaggagatgatcgatcgcctgctgtttgtgcaggcgctggag
accgtgcgctgcctcgacgaaggtgtgctgacctcggtggccgacgccaacatcgggagc
gtcttcggctggggttttgcgccgtttcacgggggtacgctccagttcatcaacgcctac
ggcctggagcgctttgtggcgcgcgccgaagcgctggccgcgcgctatggcgaacggttc
acgccgccggagcggcttcgcgacaatggcccgccgcggtga

DBGET integrated database retrieval system