KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1534Help
Entry
Rhom172_1534      CDS       T01606                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rhom172_1534
   01230 Biosynthesis of amino acids
    Rhom172_1534
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rhom172_1534
   00051 Fructose and mannose metabolism
    Rhom172_1534
   00562 Inositol phosphate metabolism
    Rhom172_1534
Enzymes [BR:rmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rhom172_1534
Exosome [BR:rmg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rhom172_1534
  Exosomal proteins of bladder cancer cells
   Rhom172_1534
  Exosomal proteins of melanoma cells
   Rhom172_1534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1746330..1747079)
Genome map
AA seq 249 aa AA seqDB search
MLVAGNWKMHTDREEAIRLAEAVVAEVGDPGSVQVAVCPPFVNLEVVRQIIEGTPIRLGA
QNMHYEEAGAYTGEVSAPMLKSVGCRYVILGHSERRQYFGETDEDVNRKIKRALQYELIP
IVCVGETLEERQAGQAAAVVERQVRAALDGVALHSAEALVIAYEPVWAIGTGHTATPEQA
QEMHALIRRLLIDRYGEAIGRALHILYGGSVKPGNAADLFAQPDVDGGLIGGASLKAADF
AAIVRAAHC
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgctggtagccggtaactggaaaatgcacacggaccgggaggaagccattcgtctggcc
gaagctgtcgtcgccgaggtgggcgatcccggttcggtacaggtggccgtgtgtccgccg
ttcgtcaacctggaagtggtgcgtcagatcatcgaaggcacgccgatccggctgggcgcg
cagaacatgcactacgaggaggcgggcgcttacacgggcgaagtatcggcacccatgctg
aagtcggtgggctgtcggtacgtgattctcggccactcggagcggcgccagtacttcggc
gagaccgacgaggacgtcaatcgcaagatcaagcgggcccttcagtacgaattgattccg
atcgtctgtgtgggggagacgctggaagagcggcaggccggccaggcggcggccgtggtg
gagcgtcaggtgcgggcggccctggacggcgtcgcgctacattcggccgaggcgctggtg
atcgcctacgagccggtctgggccatcgggacgggccacacagccacgccggagcaggcg
caggagatgcacgcgctgattcgtcgcctgctgatcgaccggtacggcgaggccatcggc
cgcgcgctgcacatcctgtacgggggaagcgtcaaaccgggcaatgcggccgatctgttt
gcgcagccggacgtcgacggcgggctgatcggcggcgccagcctcaaggccgccgacttt
gcagcgatcgtgcgggccgcccactgctga

DBGET integrated database retrieval system