KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1825Help
Entry
Rhom172_1825      CDS       T01606                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rhom172_1825
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rhom172_1825
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rhom172_1825
Enzymes [BR:rmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rhom172_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2089833..2090693)
Genome map
AA seq 286 aa AA seqDB search
MPCPCKIQDDMIDRLQSMFATLRARGEKAMGLFLTNGFPDPESTRPLLEVIDEAGADFIE
LGMPFSDPLAEGVPIQRASERALRHGVRLTDAIRTAEWFRARSQTPLLLMGYVNPIYRYG
YRAFCRDAAQAGVDGLILADLPPEESAELDEAAREAGLAMVYLIAPNTPDERIRAIDERA
TGFVYAVSVTGLTGSQLPDHAAVEAYLQRARRQIRRNPLLVGFGIKSHEDARRLSRHTDG
FIVGSALIRLVERLWDDPALTPEERLASVRRFVHALKYGTPVQVGT
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgcccctgtaaaatccaggacgacatgatcgatcgcctgcaatcgatgttcgca
acgttgcgggcccgtggtgagaaggccatgggcctgtttctgacgaacgggtttccggat
ccggaaagcacccgcccgttgctggaggtcatcgacgaggccggcgcggatttcatcgag
ctgggcatgcccttcagcgatccgctggccgaaggcgtgccgatccagcgtgccagcgag
cgggcactccgccacggcgtgcgcctgaccgacgccatccgcacggccgaatggttccgg
gcacggagccagacgccgctgctgctcatgggctacgtcaacccgatctatcgctacggc
taccgggccttctgccgcgatgcggcgcaggcgggcgtggacgggttgatcctggccgat
ctgccaccggaagaaagcgcggaactggacgaagccgcccgcgaggcagggctggccatg
gtctatctgatcgccccgaacacgccggacgagcgcatccgggcgatcgacgagcgcgcc
accggtttcgtctatgccgtatcggtgaccggactgaccgggagccagttgcccgaccat
gcggctgtcgaggcctatctgcagcgggcccgccgccagatccggcgcaatccgctgctc
gtgggctttggcatcaaatcgcacgaagacgcccggcgcctgagccgccacacggacggc
tttatcgtgggctcggcgctgatccggctggtcgagcggctctgggacgatccggcgctt
acgccggaggagcggctggcgtctgtgcgccggttcgtacatgcgctgaagtacggcacg
ccggtccaggtgggcacctga

DBGET integrated database retrieval system