KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1825Help
Entry
Rhom172_1825      CDS       T01606                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00260  Glycine, serine and threonine metabolism
rmg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rmg01100  Metabolic pathways
rmg01110  Biosynthesis of secondary metabolites
rmg01130  Biosynthesis of antibiotics
rmg01230  Biosynthesis of amino acids
Module
rmg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rhom172_1825
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rhom172_1825
Enzymes [BR:rmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rhom172_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB Peripla_BP_6 BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEN73739
UniProt: G2SHY1
Position
complement(2089833..2090693)
Genome map
AA seq 286 aa AA seqDB search
MPCPCKIQDDMIDRLQSMFATLRARGEKAMGLFLTNGFPDPESTRPLLEVIDEAGADFIE
LGMPFSDPLAEGVPIQRASERALRHGVRLTDAIRTAEWFRARSQTPLLLMGYVNPIYRYG
YRAFCRDAAQAGVDGLILADLPPEESAELDEAAREAGLAMVYLIAPNTPDERIRAIDERA
TGFVYAVSVTGLTGSQLPDHAAVEAYLQRARRQIRRNPLLVGFGIKSHEDARRLSRHTDG
FIVGSALIRLVERLWDDPALTPEERLASVRRFVHALKYGTPVQVGT
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgcccctgtaaaatccaggacgacatgatcgatcgcctgcaatcgatgttcgca
acgttgcgggcccgtggtgagaaggccatgggcctgtttctgacgaacgggtttccggat
ccggaaagcacccgcccgttgctggaggtcatcgacgaggccggcgcggatttcatcgag
ctgggcatgcccttcagcgatccgctggccgaaggcgtgccgatccagcgtgccagcgag
cgggcactccgccacggcgtgcgcctgaccgacgccatccgcacggccgaatggttccgg
gcacggagccagacgccgctgctgctcatgggctacgtcaacccgatctatcgctacggc
taccgggccttctgccgcgatgcggcgcaggcgggcgtggacgggttgatcctggccgat
ctgccaccggaagaaagcgcggaactggacgaagccgcccgcgaggcagggctggccatg
gtctatctgatcgccccgaacacgccggacgagcgcatccgggcgatcgacgagcgcgcc
accggtttcgtctatgccgtatcggtgaccggactgaccgggagccagttgcccgaccat
gcggctgtcgaggcctatctgcagcgggcccgccgccagatccggcgcaatccgctgctc
gtgggctttggcatcaaatcgcacgaagacgcccggcgcctgagccgccacacggacggc
tttatcgtgggctcggcgctgatccggctggtcgagcggctctgggacgatccggcgctt
acgccggaggagcggctggcgtctgtgcgccggttcgtacatgcgctgaagtacggcacg
ccggtccaggtgggcacctga

DBGET integrated database retrieval system