KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1864Help
Entry
Rhom172_1864      CDS       T01606                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rhom172_1864
Enzymes [BR:rmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Rhom172_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2130046..2131590
Genome map
AA seq 514 aa AA seqDB search
MHGLPRSSGILLHPTSLPGPFGIGDLGPAAYRFVDFLVEAGQRLWQMLPLVPVGLGFSPY
ASPSTFAGNPLLISPERLVEQGLLQPDDIARPPDFPEDRVDYDWVIVYKQHLLEKAYATF
EAHPERVDETDFWLFCEKQAYWLDDYALFMALKEAHGGALWTEWPIELVRRDPAALHRAR
QELARSFRKHQFWQYLFHKQWMDLRAYCHERGIRLMGDIPIYVAHDSADVWAHPHLFHLD
ERGHPTVVAGVPPDYFSETGQRWGNPLYRWDVSRETGHHWWTQRFAALLEKVDLIRLDHF
RGFAAYWEIPASEPTAVNGRWVPGPGAEFFETIQQKLGPLPIVAENLGVITPDVTELMER
FGFPGMAVLQFAFDDDATSTFLPHNYTRNLVAYTGTHDNDTIVGWWRGANKTTLPPEVVA
RAKAYARAYLDLDRKREREIHWTCIRALMASVAELVVFPMQDVLGLGSEARMNTPGTSGP
HNWSWRLRADQLRPDVAERLRSLTEIYGRLLPAS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcacggtcttcctcgttccagcgggattctgctgcatccgacctcgctgccggggccc
ttcgggatcggcgatctgggaccggccgcctatcggtttgtcgactttctggtcgaggcc
ggccagcggctctggcagatgctgccgctcgtgcccgtgggactcggtttttcgccctac
gccagcccttcgacgtttgcgggcaatcccctgctgatcagtccggagcggctggtcgaa
cagggcctgctgcagcccgacgacatcgcccgaccgcctgactttcccgaagaccgtgtg
gactacgactgggtgatcgtctacaagcagcacctgctggagaaagcctacgccacgttc
gaggcacatccggaacgggtggatgaaaccgacttctggcttttctgcgaaaagcaggcc
tactggctcgacgattacgcgctgttcatggcgctcaaggaggcgcacggcggcgcgctc
tggaccgagtggccgatcgagctggtccgacgcgaccccgccgcgctgcatcgcgcccgc
caggagctggcccgttcgttccgcaagcaccagttctggcagtacctctttcacaaacag
tggatggacctgcgggcttactgccacgagcggggcatccggctcatgggcgacatcccg
atctacgtcgcgcacgacagcgccgacgtctgggcccatccgcacctgttccatctggac
gagcgcggccatcccacggtagtggccggcgtgccgcccgattacttcagcgagacgggt
cagcgctggggcaatccgctctaccgctgggacgtctcgcgcgagaccggccatcactgg
tggacgcaacgcttcgccgccctgctggaaaaagtggacctgatccggctggaccacttc
cggggctttgccgcctactgggagattccggccagcgaaccgacggctgtcaacggccgc
tgggtgcccggccccggtgccgagtttttcgagacgatccagcagaagctggggccgctc
cccatcgtggccgaaaacctgggcgtcatcacacccgacgtgaccgagctcatggagcgc
ttcggctttccgggcatggctgtgctccagttcgccttcgacgacgacgccacgtccacc
ttcctgccccacaactacacgcgcaacctggtggcctacaccggcacgcacgacaacgac
acgatcgtgggctggtggcggggcgcaaacaaaaccacgctgccgccggaggtcgtcgcc
cgcgccaaagcatacgctcgcgcctatctggacctggaccgcaagcgcgaacgcgaaatc
cactggacctgcattcgtgcgctcatggcctcggtggccgagctcgtagtgtttcccatg
caggacgtgctcggcctgggcagcgaggcccgcatgaacacgcccggcacaagcggcccg
cacaactggtcctggcgcctgcgcgccgaccagctccgcccggacgtggccgagcggctg
cgctcgcttaccgagatctatggccggctgctaccggcctcgtaa

DBGET integrated database retrieval system