KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2076Help
Entry
Rhom172_2076      CDS       T01606                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rmg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2363294..2364316
Genome map
AA seq 340 aa AA seqDB search
MEMQTTRSVTLSLIERPRRLRRTEAIRRMVRETRLSVDRLVAPLFVVEGHGMCQEVPSMP
GQYRLSIDELVREVRELHALGIPAVALFPALDESLKTPDGREALNPDGLYPRAIRAVKEA
VPELLVITDVALDPYSSDGHDGIVRDGRILNDETVEILARMAVVQAQAGADIVAPSDMMD
GRVGAIRQALDEAGFVDVAILSYTAKYASAFYGPFRDALDSAPRHRPGVPPDKKTYQMDP
ANAREALRELRLDLEEGADMVMVKPALPYLDVIYRVKQASDVPVAAYHVSGEYAMLKAAA
LNGWLDEKAAVLEALTAIARAGADVILTYFAKQVAQWLQK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgcagactacccgaagcgtgacgctttcgctgatcgagcgcccccgtcggttg
cgtcggaccgaagccatccggcgcatggtgcgcgaaacgcgcctgtcggtggaccggctc
gtagcgccgctgttcgtcgtcgaaggccacggcatgtgccaggaagtgccctcgatgccg
ggtcagtaccggctcagcatcgacgaactggtgcgggaggtgcgggaactgcacgcgctg
ggcatcccggccgtggcgttgtttccggcgctggacgaatcgctcaagacgcccgacggc
cgcgaggcgctcaatccggacggcctctatccccgggccatccgggcggtcaaggaggcc
gtgcccgagctgctggtcatcaccgacgtggcgctggacccctactcgtcggacggacac
gacgggatcgtacgtgacggccgcattctcaacgacgagacggtggaaatcctggcccgg
atggccgtcgtgcaggcgcaggccggcgccgacatcgtggctccttcggacatgatggac
ggccgcgtgggcgccatccgccaggccctcgatgaagccggctttgtcgacgtagccatt
ctttcctacaccgccaagtacgcctcggcgttttatggtcccttccgggacgcgctcgac
tcggccccgcgccatcggcccggcgtcccgccggacaagaaaacctaccagatggacccg
gccaacgcccgtgaagcgctgcgcgagctgcggctggatctggaagaaggcgccgacatg
gtcatggtcaagccggcgctcccctacctggacgtcatctatcgggtaaagcaggcttct
gatgtgccggtggccgcctaccacgtcagcggcgagtacgccatgctcaaggcggccgcg
ctgaacggctggcttgacgaaaaggccgcggtgctcgaagcactcacggccatcgctcgc
gccggtgccgacgtgatcctcacctacttcgccaaacaggttgcgcaatggctgcagaag
taa

DBGET integrated database retrieval system