KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2110Help
Entry
Rhom172_2110      CDS       T01606                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rhom172_2110
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rhom172_2110
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rhom172_2110
Two-component system [BR:rmg02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Rhom172_2110
Bacterial motility proteins [BR:rmg02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rhom172_2110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2395384..2396442
Genome map
AA seq 352 aa AA seqDB search
MIRVLIVDDSAFMRKALSIMLEGDPEIEVVGTARDGLEAIEKVRELKPDIVTLDVEMPRM
DGLTALRRIMREHPVPVIMVSSLTQEGAQATIEALEAGAVDFIPKQHSYVSIEISRIRAE
LLEKIKTIARTRPLPTRRRSAAPDAEALPALRFREARAIAIGVSTGGPRALQQVIPTLPA
DLPVPVLIVQHMPPHFTRSLAERLNSLSPLTVVEAEEGMSLEPGRVFLAPGGRHLVLERR
NGHTPLIRTPVEPATLHRPSVDVMFQSVCQIFGGKVLAVVMTGMGRDGLEGARLIKQHGG
KVITQDEASCVVYGMPRAVAEAGLSDAVLPLEQIGPVLARSVGCMPVAQPTS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgtactcatcgtcgacgattcggctttcatgcgcaaggcgctctccatcatg
ctggagggcgatccggaaatcgaggtcgtgggcacggcccgggacgggctggaagccatc
gagaaagtacgggaactcaagcccgacatcgttacgctcgacgtcgagatgccgcgcatg
gacgggctgacggcgctgcggcgcatcatgcgcgagcatcccgtgcccgtcatcatggtc
agttcgctgacgcaggaaggcgcgcaggcgacgatcgaagcgctggaagccggtgccgtc
gatttcatccccaagcagcactcgtacgtctccatcgaaatctcgcgcattcgcgccgaa
ctgctggaaaaaatcaagacgatcgcccgcacgcgtccgctaccgacgcgccgcaggtcc
gccgccccggacgccgaggcgctgccggcgcttcgctttcgcgaagcccgcgccattgcc
atcggcgtttccaccggcggccctcgcgccctccagcaggtcattccgacgcttccggcc
gacctgcccgtgccggtgctgatcgtccagcacatgcccccgcactttacccgctcgctc
gccgagcggttgaacagcctcagtccgctgacggtggtcgaagcggaagaaggcatgtca
ctggaacccgggcgggtctttctggcccccggcggtcgccatctggtgctcgaacgtcgc
aacggccacacgccgctaatccgaacccctgtcgaaccggccacgctgcaccgcccctcg
gtggatgtcatgtttcagagcgtctgccagatctttgggggcaaggtgctggccgtcgtg
atgaccggcatgggccgcgacggcctggaaggcgcccgcctgatcaagcagcacggcggc
aaggtgatcacccaggacgaagcaagctgcgtggtctacggcatgccccgcgccgtggcc
gaagccggactgagcgacgccgtgctgccgctggagcagatcggtccggtgctggcccgc
agcgtaggctgcatgcctgtcgcccaacctacctcctaa

DBGET integrated database retrieval system