KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2159Help
Entry
Rhom172_2159      CDS       T01606                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rhom172_2159
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rhom172_2159
Enzymes [BR:rmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Rhom172_2159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2452167..2453126)
Genome map
AA seq 319 aa AA seqDB search
MSTSTETPLQGRLRHRHLLGLATYSAEEIQLILQTARQFREVLERPIRRVPTLRGVTVVN
LFFEPSTRTRISFELAEKRLSADVVNFSAAGSSVVKGETLKDTARNLEAMKIDMVVIRHR
SPGAAHFLTRCIDAVVINAGDGAHEHPTQALLDLLTISDYFPSFEGLNVSIIGDITHSRV
ARSNIYGLKALGANVTLCGPRTLMPVGIEELGVRVTYRLEEALEGCDVAMALRLQLERQT
AGLFPSLREYHERYGIKLEHLERYPDLLVMHPGPVNRGVELASEVVDHERAIILNQVTNG
VAVRMAVLYLLAGMPEAAD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgtcaaccgagacgccgcttcagggccggctccggcatcgacacctgctgggg
ctggccacctattccgccgaggagattcagctcattctgcaaacggcccgccagttccgg
gaagtgctcgaacgccccatccggcgcgtgcccacgctccggggcgtgacggtggtcaac
ctgtttttcgagccgtccacgcgcacgcgcatctccttcgagctggccgaaaagcgcctg
tcggccgacgtggtcaacttctcggcggcggggtcctcggtggtcaagggcgaaacgctc
aaagacacggcccgcaacctggaggccatgaaaatcgacatggtcgtcatccggcatcgc
tcgccgggggcggcccattttctcacgcgctgcatcgacgccgtcgtcatcaacgccggc
gacggcgcccacgagcacccgacgcaggcgctgctggatttgctgactatctcggactac
ttcccctcgttcgaggggctgaacgtctcgatcatcggcgacatcacgcacagccgggtg
gcccgctccaacatctacggcctgaaggcgctgggagccaacgtgacgctctgcgggccg
cgtacgctcatgccggtgggtatcgaggagctgggcgtgcgcgtcacctaccggctggaa
gaggcgctggagggctgcgatgtggccatggcgctgcggctgcagctcgagcgtcagacg
gccggcctgtttcccagcctgcgcgagtaccacgaacgctacggcatcaagctggagcat
ctggagcgctacccggacctgctcgtcatgcatccgggacccgtcaaccggggcgtcgaa
ctggccagcgaggtcgtcgatcacgaacgggccattatcctgaaccaggtcaccaacggc
gtggccgtgcgcatggccgtgctctacctgctggccggcatgcccgaagccgccgattga

DBGET integrated database retrieval system